halophila ovalis/цыстэін

Спасылка захоўваецца ў буферы абмену

АртыкулыКлінічныя выпрабаванніПатэнты

Выберыце тып сартавання

5 вынікі

Sequence-specific assignment of the 1H and 15N nuclear magnetic resonance spectra of the reduced recombinant high-potential iron-sulfur protein I from Ectothiorhodospira halophila.

Перакладаць артыкулы могуць толькі зарэгістраваныя карыстальнікі

Увайсці / Зарэгістравацца

A 1H and 15N NMR investigation through two-dimensional and three-dimensional spectroscopy has been performed on the reduced form ([Fe4S4]2+) of the recombinant high-potential iron-sulfur protein (HiPIP) I from Ectothiorhodospira halophila expressed in Escherichia coli. [Fe4S4]2+ clusters in proteins

The solution structure refinement of the paramagnetic reduced high-potential iron-sulfur protein I from Ectothiorhodospira halophila by using stable isotope labeling and nuclear relaxation.

Перакладаць артыкулы могуць толькі зарэгістраваныя карыстальнікі

Увайсці / Зарэгістравацца

The reduced high-potential iron sulfur protein I from Ectothiorhodospira halophila which contains the [4Fe-4S]2+ polymetallic center has been fully labeled with 15N and 13C. The protein is paramagnetic, the nuclear relaxation times of nuclei close to the paramagnetic ion are drastically shortened

Heterologous production of Halorhodospira halophila holo-photoactive yellow protein through tandem expression of the postulated biosynthetic genes.

Перакладаць артыкулы могуць толькі зарэгістраваныя карыстальнікі

Увайсці / Зарэгістравацца

The photoactive yellow protein (PYP) is a bacterial photoreceptor which is the structural prototype for the PAS domain superfamily of regulators and receptors. PYP is known to have a unique p-hydroxycinnamic acid chromophore, covalently attached to a cysteine. To date, it has not been shown how

Site-specific mutations provide new insights into the origin of pH effects and alternative spectral forms in the photoactive yellow protein from Halorhodospira halophila.

Перакладаць артыкулы могуць толькі зарэгістраваныя карыстальнікі

Увайсці / Зарэгістравацца

Acid/base titrations of wild-type PYP and mutants, either in buffer or in the presence of chaotropes such as thiocyanate, establish the presence of four spectral forms including the following: a neutral form (446-476 nm), an acidic form (350-355 nm), an alkaline form (430-440 nm), and an

Primary structure of a photoactive yellow protein from the phototrophic bacterium Ectothiorhodospira halophila, with evidence for the mass and the binding site of the chromophore.

Перакладаць артыкулы могуць толькі зарэгістраваныя карыстальнікі

Увайсці / Зарэгістравацца

The complete amino acid sequence of the 125-residue photoactive yellow protein (PYP) from Ectothiorhodospira halophila has been determined to be MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKEVIGKNFFKDVAP+ ++ CTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV. This is the first

Далучайцеся да нашай
старонкі ў facebook

Herbal & Natural Medicine

Самая поўная база дадзеных пра лекавыя травы, падтрыманая навукай

Працуе на 55 мовах
Лячэнне травой пры падтрымцы навукі
Распазнаванне траў па малюнку
Інтэрактыўная GPS-карта - пазначце травы па месцы (хутка)
Чытайце навуковыя публікацыі, звязаныя з вашым пошукам
Шукайце лекавыя зёлкі па іх уздзеянні
Арганізуйце свае інтарэсы і будзьце ў курсе навінавых даследаванняў, клінічных выпрабаванняў і патэнтаў

Увядзіце сімптом альбо захворванне і прачытайце пра зёлкі, якія могуць дапамагчы, набярыце траву і паглядзіце хваробы і сімптомы, супраць якіх яна выкарыстоўваецца.
* Уся інфармацыя заснавана на апублікаваных навуковых даследаваннях