halophila nipponica/l κυστεϊνη

Ο σύνδεσμος αποθηκεύεται στο πρόχειρο

ΆρθραΚλινικές δοκιμέςΔιπλώματα ευρεσιτεχνίας

Επιλέξτε τύπο ταξινόμησης

5 Αποτελέσματα

Sequence-specific assignment of the 1H and 15N nuclear magnetic resonance spectra of the reduced recombinant high-potential iron-sulfur protein I from Ectothiorhodospira halophila.

Μόνο εγγεγραμμένοι χρήστες μπορούν να μεταφράσουν άρθρα

Σύνδεση εγγραφή

A 1H and 15N NMR investigation through two-dimensional and three-dimensional spectroscopy has been performed on the reduced form ([Fe4S4]2+) of the recombinant high-potential iron-sulfur protein (HiPIP) I from Ectothiorhodospira halophila expressed in Escherichia coli. [Fe4S4]2+ clusters in proteins

The solution structure refinement of the paramagnetic reduced high-potential iron-sulfur protein I from Ectothiorhodospira halophila by using stable isotope labeling and nuclear relaxation.

Μόνο εγγεγραμμένοι χρήστες μπορούν να μεταφράσουν άρθρα

Σύνδεση εγγραφή

The reduced high-potential iron sulfur protein I from Ectothiorhodospira halophila which contains the [4Fe-4S]2+ polymetallic center has been fully labeled with 15N and 13C. The protein is paramagnetic, the nuclear relaxation times of nuclei close to the paramagnetic ion are drastically shortened

Heterologous production of Halorhodospira halophila holo-photoactive yellow protein through tandem expression of the postulated biosynthetic genes.

Μόνο εγγεγραμμένοι χρήστες μπορούν να μεταφράσουν άρθρα

Σύνδεση εγγραφή

The photoactive yellow protein (PYP) is a bacterial photoreceptor which is the structural prototype for the PAS domain superfamily of regulators and receptors. PYP is known to have a unique p-hydroxycinnamic acid chromophore, covalently attached to a cysteine. To date, it has not been shown how

Site-specific mutations provide new insights into the origin of pH effects and alternative spectral forms in the photoactive yellow protein from Halorhodospira halophila.

Μόνο εγγεγραμμένοι χρήστες μπορούν να μεταφράσουν άρθρα

Σύνδεση εγγραφή

Acid/base titrations of wild-type PYP and mutants, either in buffer or in the presence of chaotropes such as thiocyanate, establish the presence of four spectral forms including the following: a neutral form (446-476 nm), an acidic form (350-355 nm), an alkaline form (430-440 nm), and an

Primary structure of a photoactive yellow protein from the phototrophic bacterium Ectothiorhodospira halophila, with evidence for the mass and the binding site of the chromophore.

Μόνο εγγεγραμμένοι χρήστες μπορούν να μεταφράσουν άρθρα

Σύνδεση εγγραφή

The complete amino acid sequence of the 125-residue photoactive yellow protein (PYP) from Ectothiorhodospira halophila has been determined to be MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKEVIGKNFFKDVAP+ ++ CTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV. This is the first

Γίνετε μέλος της σελίδας
μας στο facebook

Herbal & Natural Medicine

Η πληρέστερη βάση δεδομένων φαρμακευτικών βοτάνων που υποστηρίζεται από την επιστήμη

Λειτουργεί σε 55 γλώσσες
Βοτανικές θεραπείες που υποστηρίζονται από την επιστήμη
Αναγνώριση βοτάνων με εικόνα
Διαδραστικός χάρτης GPS - ετικέτα βότανα στην τοποθεσία (σύντομα)
Διαβάστε επιστημονικές δημοσιεύσεις που σχετίζονται με την αναζήτησή σας
Αναζήτηση φαρμακευτικών βοτάνων με τα αποτελέσματά τους
Οργανώστε τα ενδιαφέροντά σας και μείνετε ενημερωμένοι με την έρευνα ειδήσεων, τις κλινικές δοκιμές και τα διπλώματα ευρεσιτεχνίας

Πληκτρολογήστε ένα σύμπτωμα ή μια ασθένεια και διαβάστε για βότανα που μπορεί να βοηθήσουν, πληκτρολογήστε ένα βότανο και δείτε ασθένειες και συμπτώματα κατά των οποίων χρησιμοποιείται.
* Όλες οι πληροφορίες βασίζονται σε δημοσιευμένη επιστημονική έρευνα