Anti-inflammatory peptides, and uses thereof

CROSS REFERENCE TO RELATED APPLICATIONS

This application is a 371 National Phase Entry of International Patent Application No. PCT/EP2016/067090 filed on Jul. 18, 2016 which claims benefit under 35 U.S.C. .sctn. 119(b) of EP Application No. 15177013.8 filed Jul. 16, 2015 and EP Application No. 15177017.9 filed Jul. 16, 2015, the contents of which are incorporated herein by reference in their entirety.

SEQUENCE LISTING

The sequence listing of the present application has been submitted electronically via EFS-Web as an ASCII formatted sequence listing with a file name "SEQTXT-1-048262-091330.txt", creation date of Oct. 5, 2018 and a size of 359,048 bytes. The sequence listing submitted via EFS-Web is part of the specification and is herein incorporated by reference in its entirety.

BACKGROUND TO THE INVENTION

It is estimated that a staggering 2 billion people worldwide suffer from some type of inflammation. Inflammation is a vast biological process and an integral part of our immune response. The inflammatory response may be acute (short lived) or chronic (longer lasting) and can occur in almost every part of the body whether it be internal or external. Interestingly as well, whatever the cause of inflammation, the biological changes that occur within the body due to the inflammation response are the same throughout the body, meaning the modes of reducing inflammation, which different anti-inflammatory agents carry are the same in all parts of the body.

Typically, inflammation is a natural response and a necessary one that rids the cells of injury causes, foreign attacks, or removes dead cells. However, excess inflammation has drastic and sometimes detrimental effects on the human body. Indeed, an inflammatory response can have long-lasting, negative consequences such as tissue damage. During an inflammatory response, the body releases lysosomal enzymes which can damage tissue and can even lead to a life-threatening hypersensitivity reaction. These conditions can have long-lasting effects both externally, with the development of acute skin rashes and eczema, and internally, triggering diseases such as inflammatory bowel disease. As a result, maintaining a normal level of inflammation is very important for our health and wellbeing, both inside and out. Unfortunately, inflammation is on the rise. One of the major factors of this increase comes from our exposure to an increasing variety of external agents that our bodies are not accustomed to.

Most anti-inflammatory treatments used today are drugs. There are two major types of anti-inflammatory drugs, corticosteroids and non-steroidal anti-inflammatory drugs (NSAIDs). These include: Immunosuppressives (methotrexate, ciclosporin); Specific biological drugs (mostly TNF-alpha inhibitors, but also inhibitors of cyclooxygenase enzyme for example); Cytotoxic drugs; and Oral retinoids (acitretin). Furthermore, topical treatments exist to specifically reduce skin inflammation. Examples include creams and ointment (mostly cortisone based), and physical treatments like UV radiations. These drugs however have drastic side-effects such as gastrointestinal toxicity and anaphylactoid reactions. They can even suppress the immune system to such a point that it is made vulnerable to other diseases and pathogens.

Therefore, there is a clear need for the identification of agents having anti-inflammatory activity that are not immunosuppressive and/or cause other undesirable side effects. To that end, very specific types of food are known to reduce inflammation (Kiecolt-Glaser J. K. et al. 2010, Middleton E. et al. 2000, Chatterjee M. et al. 2005). Indeed, particular components of these specific foods are in low concentrations, hidden, or locked away, and once identified and unlocked can be scaled to specifically target inflammation in a recognized way, as our bodies understand the components of food and are able to readily process these molecules. Indeed, these particular food molecules can reduce inflammation without completely blocking this immune system response which puts the body in a vulnerable state. For those with many food allergies as well, identifying and unlocking the particular components of a food that may reduce inflammation would allow for these individuals to gain the anti-inflammatory benefits of a food they would otherwise be allergic to.

It is an object of the invention to overcome at least one of the above-referenced problems.

STATEMENTS OF INVENTION

The pea genome codes for over 70,000 different proteins. The Applicant has identified seven of these proteins, each of which contains one or more anti-inflammatory fragments. Likewise, out of the more than 60,000 proteins encoded by the rice genome, the Applicant has identified eight proteins, each of which contains one or more anti-inflammatory fragments. The anti-inflammatory fragments of the sixteen identified proteins have been shown to have anti-inflammatory activity when incubated with LPS-stimulated human cells (FIGS. 1 to 19), do not cause human cell viability issues (FIG. 20) and are not toxic to human cells (FIG. 21). The specific plant proteins from which the natural peptides are derived are provided in SEQ ID NO: 1-15 and 353-355, especially from regions of the proteins provided in SEQ ID NO: 17-69. The specific pea proteins from which the peptides are derived are provided in SEQ ID NO: 1 to 5, 8 and 9, and the specific rice proteins from which the peptides are derived are provided in SEQ ID NO: 6, 7 and 10 to 15. Homologs of these proteins are described in SEQ ID NO: 222-267. The specific peptides initially identified in the pea proteins are shown in SEQ ID Nos: 71-107 and 110-111. The specific peptides initially identified in the rice proteins are shown in SEQ ID Nos: 108-109 and 112-220. Additional peptides of the invention identified in the pea and rice proteins are provided herein, for example in SEQ ID NO: 320, 331 to 352, and 356-424. The peptide of the invention encompasses peptides comprising or consisting of any of the afore-mentioned peptides.

TABLE-US-00001 (SEQ ID 331) EWQINEK - Fragment of rice protein of SEQ ID 7 (SEQ ID 332) FLPQHTD - Fragment of pea protein of SEQ ID 1 (SEQ ID 333) GPQQYAEWQINEK - Fragment of rice protein of SEQ ID 7 (SEQ ID 334) PGQLQSFLLSGN - Fragment of pea protein of SEQ ID 1 (SEQ ID 335) PGQLQSFLLSGNQNQQNYLSGF - Fragment of pea protein of SEQ ID 1 (SEQ ID 336) PQQYAEWQ - Fragment of rice protein of SEQ ID 7 (SEQ ID 337) QLQSFLLSGNQNQQNYLSGFSK - Fragment of pea protein of SEQ ID 1 (SEQ ID 338) QNQQNYLSGFSK - Fragment of pea protein of SEQ ID 1 (SEQ ID 339) QSFLLSGNQNQQ - Fragment of pea protein of SEQ ID 1 (SEQ ID 340) QSFLLSGNQ - Fragment of pea protein of SEQ ID 1 (SEQ ID 341) RGPQQYA - Fragment of rice protein of SEQ ID 7 (SEQ ID 342) DALEPDNR - Fragment of pea protein of SEQ ID 354 (SEQ ID 343) SEEGYYGEQQQQPGMTR - Fragment of rice protein of SEQ ID 353 (SEQ ID 344) GYYGEQQQQPGMTR - Fragment of rice protein of SEQ ID 353 (SEQ ID 345) IDGYDTPVEGR - Fragment of rice protein of SEQ ID 15 (SEQ ID 346) NGVLRPGQL - Fragment of rice protein of SEQ ID 14 (SEQ ID 347) RHGEWGPSY (SEQ ID 348) FWM - Fragment of pea protein of SEQ ID 3 [SEQ ID 349] TVFDGVLRPGQL - Fragment of rice protein of SEQ ID 10 [SEQ ID 350] RLQSQNDQRGEIIHVK - Fragment of rice protein of SEQ ID 10 [SEQ ID 351] HGPVEMPYTLLYPSSK - Fragment of pea protein of SEQ ID 355 [SEQ ID 352] LDALEPDNR - Fragment of pea protein of SEQ ID 354 [SEQ ID 320] RGPQQYAEWQINE - Fragment of rice protein SEQ ID 7

The peptides of the invention are primarily useful for causing a decrease in inflammation, and therefore have utility in the prevention or treatment of inflammatory conditions and maintaining gut health in mammals.

In a first aspect, the invention provides a peptide, typically 3 to 50 amino acids in length, and comprising a fragment of a protein disclosed herein, for example selected from SEQ ID NOs: 1 to 16, 349 or 350, or a homolog thereof, or a variant or fragment of the peptide (hereafter "peptide of the invention"). In one embodiment, the peptide or variant or fragment thereof is bioactive. In one embodiment, the peptide or variant or fragment thereof has anti-inflammatory activity.

In one embodiment, the peptide of the invention comprises a sequence selected from SEQ ID NO: 17-220, 268-352, and 356-424.

In one embodiment, the peptide of the invention consists essentially of a sequence selected from SEQ ID NO: 17-220, 268-352, and 356-424.

In one embodiment, the peptide consists of 3-50 amino acids. In one embodiment, the peptide consists of 4-50 amino acids. In one embodiment, the peptide consists of 5-50 amino acids. In one embodiment, the peptide consists of 6-50 amino acids.

In one embodiment, the fragment has between 7 and 37 amino acids and a charge of between -9 and +3.

Preferably, the c-terminal amino acid is not cysteine (C) or methionine (M).

Preferably, the n-terminal amino acid is not cysteine (C), histidine (H), proline (P) or threonine (T)

Preferably, the c-terminal domain of the fragment does not contain cysteine (C).

Preferably, the n-terminal domain of the fragment does not contain cysteine (C).

Preferably, the fragment does not contain cysteine (C).

Preferably, the peptide does not contain cysteine (C).

Preferably, the fragment is from a region of the proteins of SEQ ID NOs: 1 to 16, which regions are characterised by the following features: 17 to 109 amino acids in length; a charge of between -6 and +4; the c-terminal amino acid is not aspartic acid (D), phenylalanine (F), methionine (M) or tryptophan (W); the n-terminal amino acid is not aspartic acid (D), histidine (H), methionine (M), proline (P) or tryptophan (W).

Preferably, the c-terminal domain of the region does not contain tryptophan (W).

Preferably, the regions of the proteins of SEQ ID NOs: 1 to 7 are selected from the SEQ ID NOs: 17-33.

Preferably, the regions of the proteins of SEQ ID NOs: 8 to 16 are selected from the SEQ ID NOs: 34-70.

Preferably, the regions of the proteins of SEQ ID NOs: 1 to 16 are selected from the SEQ ID NOs: 17-70.

Preferably, the fragment is selected from SEQ ID NOs: 71 to 221, or a variant of the fragment.

Preferably, the peptide consists of a fragment selected from SEQ ID NOs: 71 to 221, or a variant of the fragment.

Preferably, the peptide consists of a sequence selected from SEQ ID NOs: 71 to 221.

In one embodiment, the peptide comprises a fragment of a pea protein, wherein the fragment is selected from SEQ ID NO: 71-107, 332, 334, 335, 337-340, 342, 348 and 351-352.

In one embodiment, the peptide comprises a fragment of a pea protein, wherein the fragment is selected from SEQ ID NO: 71-107, 332, 334, 335, 337-340, 342, 348 and 351-352. In one embodiment, the fragment is selected from 339, 352, 351, 93, 92, 75, 76, 105.

In one embodiment, the peptide comprises a fragment of a rice protein, wherein the fragment is selected from SEQ ID NO: 108-109, 112-220, 320, 331, 333, 336, 341, 343-346, 349-350. In one embodiment, the fragment is selected from 341, 144, 320, 349, 350, 177, 343-346.

In one embodiment, the peptide is a modified peptide. In one embodiment the peptide is modified with a protecting group. In one embodiment, the peptide is modified to increase its lipophilicity. In none embodiment, the peptide is modified to increase its half-life. In one embodiment, an N or C-terminal amino acid of the peptide is modified. In one embodiment, the N or C-terminal amino acid of the peptide is modified with a protecting group.

The invention also provides a conjugate comprising a peptide of the invention conjugated to a binding partner. In one embodiment, the peptide of the invention is modified with a reactive group configured to allow conjugation to the binding partner.

[SEQ ID NO: 1 (Pea Protein 1)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 1, or a homolog thereof, or a bioactive variant of the protein fragment.

Preferably, the peptide comprises a bioactive fragment of one of seven regions of SEQ ID NO: 1, namely SEQ ID NOS: 17 to 23, or a bioactive variant of the protein fragment.

Preferably, the peptide comprises a bioactive fragment selected from SEQ ID NOS: 71 to 91 or 360, or a bioactive variant of the protein fragment.

Preferably, the peptide comprises a fragment of the region of SEQ ID NO:17, for example SEQ ID NO: 71, or a bioactive variant of the protein fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:18, for example SEQ ID NO: 72, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:19, for example either or both of SEQ ID NO: 73 or 74, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:20, for example either or both of SEQ ID NO: 75 or 76. or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:21, for example one or more or all of SEQ ID NO: 77 to 84, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:22, for example one or more or all of SEQ ID NO: 85 to 89, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:23, for example SEQ ID NO: 90 or a bioactive variant of the fragment.

Preferably, the peptide comprises SEQ ID NO: 91, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one peptide of the invention, which peptide includes a fragment of SEQ ID NO: 1 or a homolog thereof. The invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a different fragment of SEQ ID NO: 1 or a homolog thereof. Preferably, the peptide or peptides are bioactive. Preferably, the peptide or peptides are anti-inflammatory. Preferably, the composition comprises a first peptide of the invention that comprises a fragment of a first region selected from SEQ-ID NOS: 17 to 23, and a second peptide of the invention that comprises fragment of a second region selected from SEQ ID NOS: 17 to 23. Preferably, the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQ ID NO: 71 to 91 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQ ID NO: 71 to 91 (or a bioactive variant of the fragment).

Homologs of Pea Protein 1 (SEQ-ID NO: 1) include Vicia fabia, Cicer arietinum and Lens culinaris homologs (SEQ ID NO: 222-224).

[SEQ ID NO: 2 (Pea Protein 2)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 2, or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of one of two regions of SEQ ID NO: 2, namely SEQ ID NOS: 24 or 25.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:24, for example SEQ ID NO: 92, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:25, for example SEQ ID NO: 93, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 2 or a homolog thereof. The invention also provides a composition comprising at least two bioactive peptides of the invention, each of which comprises a different bioactive fragment of SEQ ID NO: 2 or a homolog thereof. Preferably, the composition comprises a first bioactive peptide comprising a bioactive fragment of the region of SEQ ID NO 24, and a second bioactive peptide comprising a bioactive fragment of the region of SEQ-ID NO 25. Preferably, the composition comprises a first bioactive peptide comprising a bioactive fragment of SEQ ID NO 92, and a second bioactive peptide comprising a bioactive fragment of SEQ-ID NO 93.

Homologs of Pea Protein 2 (SEQ ID NO: 2) include Lens culinaris, Vicia narbonensis and Glycine max (SEQ ID NO: 225-227).

[SEQ-ID NO: 3 (Pea Protein 3)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 3, or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of one of two regions of SEQ ID NO: 3, namely SEQ ID NOS: 26 or 27.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:26, for example SEQ ID NO: 94, or a bioactive variant the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:27, for example SEQ ID NO: 95, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 3 or a homolog thereof. The invention also provides a composition comprising at least two bioactive peptides of the invention, each of which comprises a different bioactive fragment of SEQ ID NO: 3 or a homolog thereof. Preferably, the composition comprises a first peptide comprising a bioactive fragment of the region of SEQ ID NO 26, and a second peptide comprising a bioactive fragment of SEQ-ID NO 27. Preferably, the composition comprises a first bioactive peptide comprising a bioactive fragment of SEQ ID NO 94 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a bioactive fragment of SEQ ID NO 95 (or a bioactive variant of the fragment).

Homologs of Pea Protein 3 (SEQ ID NO: 3) include Vicia sativa, Medicago truncatula, and Lotus japonicas (SEQ ID NO: 228-230).

[SEQ ID NO: 4 (Pea Protein 4)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 4, or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of one of five regions of SEQ-ID NO: 4, namely SEQ ID NOS: 28 to 32. Preferably, the region is SEQ ID NO: 28, preferably SEQ ID NO: 29, preferably SEQ ID NO: 30, preferably SEQ ID NO: 31, preferably SEQ ID NO: 32.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:28, for example SEQ ID NO: 96, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:29, for example SEQ ID NO: 97 to 103, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:30, for example SEQ ID NO: 104, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:31, for example SEQ ID NO: 105, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:32, for example SEQ ID NO: 106, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 4 or a homolog thereof. The invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention that comprise different bioactive fragments of SEQ ID NO: 4 or a homolog thereof. Preferably, the composition comprises a first peptide comprising a bioactive fragment of a first region selected from SEQ ID NOS: 28 to 32, and a second peptide that comprises a bioactive fragment of a second region selected from SEQ ID NOS: 28 to 32. Preferably, the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQ ID NO: 96 to 106 (or an a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQ ID NO 96 to 106 (or a bioactive variant of the fragment).

Homologs of Pea Protein 4 (SEQ ID NO: 4) include Pisum abyssinicum, Lathyrus annuus, and Vicia villosa (SEQ ID NOs: 231-233).

[SEQ ID NO: 5 (Pea Protein 5)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 5, or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of a region of SEQ ID NO: 5, namely the region of SEQ ID NO 33, for example SEQ ID NO: 107, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 5 or a homolog thereof. The invention also provides a composition comprising at least two peptides of the invention that comprise at least one bioactive fragment of SEQ ID NO: 5 or a homolog thereof, for example SEQ ID NO: 107.

Homologs of Pea Protein 5 (SEQ ID NO: 5) include Medicago truncatula, Vicia peregrine, and Vicia lutea (SEQ ID NO: 234-236).

[SEQ ID NO: 6 (Rice Protein 7--Q6K508)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 6 or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of SEQ ID NO: 108, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 6 or a homolog thereof. The invention also provides a composition comprising at least two peptides of the invention including at least one bioactive fragment of SEQ ID NO: 6 or a homolog thereof, for example SEQ ID NO: 108 (SP1).

Homologs of Rice Protein 7 (SEQ ID NO: 6) include Oryza, brachyantha, Avena sativa, and Brachypodium distachyon (SEQ ID NO: 237-239).

[SEQ ID NO: 7 (Rice Protein 8--Q6K7K6)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 7 or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of SEQ ID NO: 109 (SP2), or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 7 or a homolog thereof. The invention also provides a composition comprising at least two peptides of the invention including at least one bioactive fragment of SEQ ID NO: 7 or a homolog thereof, for example SEQ ID NO: 109 (SP2).

Homologs of Rice Protein 8 (SEQ ID NO: 7) include Oryza sativa Japonica Group, Oryza sativa Indica Group, and Oryza brachyantha (SEQ ID NO: 240-242).

[SEQ ID NO: 8 (Pea Protein 6--P13919)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 8 or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of SEQ ID NO: 110 (SP3), or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 8 or a homolog thereof. The invention also provides a composition comprising at least two peptides of the invention including at least one bioactive fragment of SEQ ID NO: 8 or a homolog thereof, for example SEQ ID NO: 110 (SP3).

Homologs of Pea Protein 8 (SEQ ID NO: 8) include Pisum fulvum, Pisum abyssinicum and Vicia villosa (SEQ ID NO: 243-245).

[SEQ ID NO: 9 (Pea Protein 7--P02855)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 9 or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of SEQ ID NO: 111 (SP4), or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 9 or a homolog thereof. The invention also provides a composition comprising at least two peptides of the invention including at least one bioactive fragment of SEQ ID NO: 9 or a homolog thereof, for example SEQ ID NO: 111 (SP4).

Homologs of Pea Protein 9 (SEQ ID NO: 9) include Lathyrus hirsutus, Lathyrus cicero, Lathyrus sativus (SEQ ID NO: 246-248).

[SEQ ID NO: 10 (Rice Protein 1--P07728)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 10 or a homolog thereof.

Preferably, the peptide comprises a fragment of one of nine regions of SEQ ID NO: 10, namely SEQ ID NOS: 34 to 42. Preferably, the region is SEQ ID NO: 34, preferably SEQ ID NO: 35, preferably SEQ ID NO: 36, preferably SEQ ID NO: 37, preferably SEQ ID NO: 38, preferably SEQ ID NO: 39, preferably SEQ ID NO: 40, preferably SEQ ID NO: 41, preferably SEQ ID NO: 42.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:34, for example SEQ ID NO: 112 or SEQ ID NO: 113 or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:35, for example SEQ ID NO: 114, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:36, for example SEQ ID NO: 115 or SEQ ID NO: 116, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:37, for example SEQ ID NO: 117 or SEQ ID NO: 118, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:38, for example SEQ ID NO: 119, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:39, for example SEQ ID NO: 120, 121 or 122, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:40, for example SEQ ID NO: 123, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:41, for example SEQ ID NO: 124, 125, 126, 127, 128 or 129, or a bioactive variant of the fragment.

Preferably, the peptide comprises a fragment of the region of SEQ ID NO:42, for example SEQ ID NO: 130, 131 or 132, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 10 or a homolog thereof. The invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a different bioactive fragment of SEQ ID NO: 10 or a homolog thereof. Preferably, the composition comprises a first peptide that comprises a bioactive fragment of a first region selected from SEQ ID NOS: 34 to 42, and a second peptide that comprises a bioactive fragment of a second region selected from SEQ ID NOS: 34 to 42. Preferably, the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQ ID NO: 112 to 132 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQ ID NO 112 to 132 (or a bioactive variant of the fragment).

Homologs of Rice Protein 1 (SEQ ID NO: 10) include Oryza brachyantha, and Zizania latifolia (SEQ ID NO: 249-251).

[SEQ ID NO: 11 (Rice Protein 2--P07728)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 11 or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of one of four regions of SEQ ID NO: 11, namely SEQ ID NOS: 43 to 46. Preferably, the region is SEQ ID NO: 43, preferably SEQ ID NO: 44, preferably SEQ ID NO: 45, preferably SEQ ID NO: 46.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:43, for example SEQ ID NO: 133 or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:44, for example SEQ ID NO: 134 to 137, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:45, for example SEQ ID NO: 138 to 144, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:46, for example SEQ ID NO:145, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQ ID NO:11 or a homolog thereof. The invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a bioactive fragment of SEQ ID NO: 11 or a homolog thereof. Preferably, the composition comprises a first peptide that comprises a bioactive fragment of a first region selected from SEQ ID NOS: 43 to 46, and a second peptide that comprises a bioactive fragment of a second region selected from SEQ ID NOS: 43 to 46. Preferably, the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQ ID NO: 133 to 145 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQ ID NO 133 to 145 (or a bioactive variant of the fragment).

Homologs of Rice Protein 2 (SEQ ID NO: 11) include Oryza sativa Indica Group, Zizania latifolia, Avena sativa (SEQ ID NO: 252-254).

[SEQ ID NO: 12 (Rice Protein 3--P07730)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 12 or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of one of eight regions of SEQ ID NO: 12, namely SEQ ID NOS: 47 to 54. Preferably, the region is SEQ ID NO: 47, preferably SEQ ID NO: 48, preferably SEQ ID NO: 49, preferably SEQ ID NO: 50, preferably SEQ ID NO: 51, preferably SEQ ID NO: 52, preferably SEQ ID NO: 53, preferably SEQ ID NO: 54.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:47, for example one of SEQ ID NO: 146 to 150, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:48, for example one of SEQ ID NO: 151 to 157, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:49, for example one of SEQ ID NO: 158 or SEQ ID NO: 159, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:50, for example one of SEQ ID NO: 160 to 162, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:51, for example one of SEQ ID NO: 163 or 164, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:52, for example SEQ ID NO: 165, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:53, for example one of SEQ ID NO: 166 to 171, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:54, for example one of SEQ ID NO: 172 to 176, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 12 or a homolog thereof. The invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a bioactive fragment of SEQ ID NO: 12 or a homolog thereof. Preferably, the composition comprises a first peptide that comprises a bioactive fragment of a first region selected from SEQ ID NOS: 47 to 54, and a second peptide that comprises a bioactive fragment of a second region selected from SEQ ID NOS: 47 to 54. Preferably, the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQ ID NO: 146 to 172 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second anti-inflammatory fragment selected from SEQ ID NO 146 to 172 (or a bioactive variant of the fragment).

Homologs of Rice Protein 3 (SEQ ID NO: 12) include Oryza brachyantha, Brachipodium distachyon (SEQ ID NO: 255-257).

[SEQ ID NO: 13 (Rice Protein 4--Q0D7S0)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 13 or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of a region of SEQ ID NO: 13, namely SEQ ID NO 55, for example SEQ ID NO: 177, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 13 or a homolog thereof. The invention also provides a composition comprising at least 2 peptides of the invention, at least one of which comprises a bioactive fragment of SEQ ID NO: 13 or a homolog thereof, for example SEQ ID NO: 177, or a bioactive variant of the fragment.

Homologs of Rice Protein 4 (SEQ ID NO: 13) include Oryza sativa Indica Group, Zizania latifolia, Avena sativa (SEQ ID NO: 252-254).

[SEQ ID NO: 14 (Rice Protein 5--P14614)]

Preferably, the peptide comprises a fragment of the protein of SEQ ID NO: 14 or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of one of seven regions of SEQ ID NO: 14, namely SEQ ID NOS: 56 to 62. Preferably, the region is SEQ ID NO: 56, preferably SEQ ID NO: 57, preferably SEQ ID NO: 58, preferably SEQ ID NO: 59, preferably SEQ ID NO: 60, preferably SEQ ID NO: 61, preferably SEQ ID NO: 62.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:56, for example one of SEQ ID NO: 178 to 180 or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:57, for example one of SEQ ID NO: 181 to 182, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:58, for example SEQ ID NO: 183, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:59, for example one of SEQ ID NO: 184 to 190, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:60, for example SEQ ID NO:191, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:61, for example one of SEQ ID NO: 192 to 195, or a bioactive variant of the fragment.

Preferably, the peptide comprises a bioactive fragment of the region of SEQ ID NO:62, for example one of SEQ ID NO: 196 to 197, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 14 or a homolog thereof. The invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a bioactive fragment of SEQ ID NO: 14 or a homolog thereof. Preferably, the composition comprises a first peptide that comprises a bioactive fragment of a first region selected from SEQ ID NOS: 56 to 62, and a second peptide that comprises a bioactive fragment of a second region selected from SEQ ID NOS: 56 to 62. Preferably, the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQ ID NO: 178 to 197 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQ ID NO 178 to 197 (or a bioactive variant of the fragment).

Homologs of Rice Protein 5 (SEQ ID NO: 14) include Oryza sativa Japonica Group, Brachipodium distachyon (SEQ ID NO: 261-263).

[SEQ ID NO: 15 (Rice Protein 6--Q0DEV5)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 15 or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of one of seven regions of SEQ ID NO: 15, namely SEQ ID NOS: 63 to 67. Preferably, the region is SEQ ID NO: 63, preferably SEQ ID NO: 64, preferably SEQ ID NO: 65, preferably SEQ ID NO: 66, preferably SEQ ID NO: 67.

Preferably, the peptide comprises a fragment of the region of SEQ ID NO:63, for example one of SEQ ID NO: 198 to 200, or a bioactive variant of the fragment.

Preferably, the peptide comprises a fragment of the region of SEQ ID NO:64, for example one of SEQ ID NO: 201 to 203 or a bioactive variant of the fragment.

Preferably, the peptide comprises a fragment of the region of SEQ ID NO:65, for example SEQ ID NO: 204 or a bioactive variant of the fragment.

Preferably, the peptide comprises a fragment of the region of SEQ ID NO:66, for example one of SEQ ID NO: 205 to 208 or a bioactive variant of the fragment.

Preferably, the peptide comprises a fragment of the region of SEQ ID NO:67, for example one of SEQ ID NO:209 to 215 or a bioactive variant of the fragment.

Preferably, the peptide comprises a fragment of the region of SEQ ID NO:68, for example one of SEQ ID NO: 216 to 219, or a bioactive variant of the fragment.

Preferably, the peptide comprises a fragment of the region of SEQ ID NO:69, for example SEQ ID NO: 220, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptide of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 15 or a homolog thereof. The invention also provides a composition comprising at least 2, preferably 3, preferably 4, preferably 5, preferably 6, preferably 7, preferably 8, preferably 9, or preferably 10 peptides of the invention, each of which comprises a bioactive fragment of SEQ ID NO: 15 or a homolog thereof. Preferably, the composition comprises a first peptide that comprises a bioactive fragment of a first region selected from SEQ ID NOS: 63 to 69, and a second peptide that comprises a bioactive fragment of a second region selected from SEQ ID NOS: 63 to 69. Preferably, the composition comprises a first bioactive peptide comprising a first bioactive fragment selected from SEQ ID NO: 198 to 220 (or a bioactive variant of the fragment), and a second bioactive peptide comprising a second bioactive fragment selected from SEQ ID NO 198 to 220 (or a bioactive variant of the fragment).

Homologs of Rice Protein 6 (SEQ ID NO: 15) include Oryza rufipogon, Oryza officinalis, Hordeum vulgare subsp. vulgare (SEQ ID NO: 264-266).

[SEQ ID NO: 16 (Bacterial Protein 1--POC1U8)]

Preferably, the peptide comprises a bioactive fragment of the protein of SEQ ID NO: 16 or a homolog thereof.

Preferably, the peptide comprises a bioactive fragment of a region of SEQ ID NO: 16, namely the region of SEQ ID NO 70. Typically, the peptide is SEQ ID NO 221, or a bioactive variant of the fragment.

The invention also provides a composition comprising at least one bioactive peptides of the invention, which peptide includes a bioactive fragment of SEQ ID NO: 16 or a homolog thereof. The invention also provides a composition comprising at least 2 peptides of the invention, at least one of which comprises a fragment of SEQ ID NO: 16 or a homolog thereof, for example SEQ ID NO: 212 or a bioactive variant of the fragment.

Homologs of Bacterial Protein 1 (SEQ ID NO: 16) include:

TABLE-US-00002 >gi|580560623|gb|EVF84961.1| glutamyl endopeptidase [Staphylococcus aureus COAS6020] >gi|580687002|gb|EVH10169.1| glutamyl endopeptidase [Staphylococcus aureus UCIM6080] >gi|751815683|gb|KIN24957.1| glutamyl endopeptidase [Staphylococcus aureus MRSA_CVM43477] >gi|781884797|dbj|BAR08486.1| glutamyl endopeptidase precursor [Staphylococcus aureus subsp. aureus] >gi|781887762|dbj|BAR11210.1| glutamyl endopeptidase precursor [Staphylococcus aureus subsp. aureus]

The invention also provides bioactive composition comprising at least one and preferably a plurality of bioactive peptides of the invention, wherein each of the peptides of the invention comprises a bioactive fragment of a protein described herein. In one embodiment the protein is selected from SEQ ID NO: 1 to 16. Typically, the or each peptide of the invention is selected from, or comprises a bioactive fragment selected from, SEQ ID NO: 71-220, or a bioactive variant of the fragment.

In one embodiment, the composition comprises a peptide of the invention, which peptide comprises a sequence selected from SEQ ID NO: 17-220, 268-352, and 356-424.

In one embodiment, the composition comprises peptide of the invention, which peptide consists essentially of a sequence selected from SEQ ID NO: 17-220, 268-352, and 356-424.

Typically, the or each peptide of the invention is selected from, or comprises a bioactive fragment selected from, SEQ ID NO: 71-107 and 110-111, or a bioactive variant of the fragment.

Typically, the or each peptide of the invention is selected from, or comprises an anti-inflammatory fragment selected from, SEQ ID NO: 108-109 and 112 to 220, or an anti-inflammatory variant of the fragment.

In embodiment, the bioactive peptide, variant or fragment of the invention is anti-inflammatory.

Preferably, the composition comprises at least two distinct peptides of the invention.

Preferably, the composition comprises at least three distinct peptides of the invention.

Preferably, the composition comprises at least four distinct peptides of the invention.

Preferably, the composition comprises at least five distinct peptides of the invention.

Preferably, the composition comprises at least six distinct peptides of the invention.

Preferably, the composition comprises at least seven distinct peptides of the invention.

Preferably, the composition comprises at least eight distinct peptides of the invention.

Preferably, the composition comprises at least nine distinct peptides of the invention.

Preferably, the composition comprises at least ten distinct peptides of the invention.

In one embodiment, the invention comprises a composition comprises one or more of SEQ ID NO: 71-107 and 110-111, or anti-inflammatory variants of the fragments, or a mixture of the anti-inflammatory fragments and variants.

In one embodiment, the composition comprises at least one, two, three, four, five or all of SEQ ID NOS 75, 91, 92, 93, 110 and 111.

In one embodiment, the composition comprises substantially all of fragments SEQ ID NO: 71-107 and 110-111.

In one embodiment, the invention comprises a composition comprises one or more of SEQ ID NO: 108-109 and 112 to 220, or anti-inflammatory variants of the fragments, or a mixture of the anti-inflammatory fragments and variants.

In one embodiment, the composition comprises at least one, two or three of SEQ ID NOS 108, 109 and 144.

In one embodiment, the composition of the invention is enriched in peptides having a molecular weight of less than 10 KD. In one embodiment, the composition is depleted of cell debris.

In one embodiment, the composition of the invention is a powder.

In one embodiment, the invention comprises a composition comprising substantially all of fragments SEQ ID NO: 108-109 and 112 to 220, or anti-inflammatory variants of the fragments, or a mixture of the anti-inflammatory fragments and variants.

In one embodiment the composition is edible (comestible). In one embodiment, the composition is a food or beverage. In one embodiment, the composition is a personal care composition. In one embodiment, the composition is a pharmaceutical composition. In one embodiment, the composition is nutritional supplement. In one embodiment, the composition is solid. In one embodiment, the composition is semi-solid (i.e. a cream, gel or lotion). In one embodiment, the composition is liquid.

The invention also relates to a comestible product comprising a peptide of the invention. Preferably the comestible product is man-made.

The invention also relates to a comestible product comprising a composition of peptides of the invention. Preferably the comestible product is man-made.

Preferably, the comestible product is a food product for human or animal (mammalian) consumption.

In one embodiment the man-made comestible product is a beverage. In one embodiment the man-made comestible product is a bakery product. In one embodiment the man-made comestible product is a dairy product. In one embodiment the man-made comestible product is a snack product. In one embodiment the man-made comestible product is a baked extruded food product. In one embodiment the man-made comestible product is powdered milk. In one embodiment the man-made comestible product is an infant formula product. In one embodiment the man-made comestible product is a confectionary product. In one embodiment the man-made comestible product is a yoghurt. In one embodiment the man-made comestible product is a yoghurt drink. In one embodiment the man-made comestible product is an ice cream product. In one embodiment the man-made comestible product is a frozen food product. In one embodiment the man-made comestible product is a breakfast cereal. In one embodiment the man-made comestible product is a bread. In one embodiment the man-made comestible product is a flavoured milk drink. In one embodiment the man-made comestible product is a confectionary bar. In one embodiment the man-made comestible product is a tea or tea product. In one embodiment the man-made comestible product is a based extruded snack product. In one embodiment the man-made comestible product is a fried snack product. In one embodiment the man-made comestible product is a nutritional supplement. In one embodiment the man-made comestible product is a sports nutritional product. In one embodiment the man-made comestible product is a baby food product. In one embodiment the man-made comestible product is a speciality food product for immunocompromised individuals. In one embodiment the man-made comestible product is a food for geriatric patients.

The invention also relates to a man-made personal care composition comprising a peptide of the invention.

The invention also relates to a man-made personal care composition comprising a composition of peptides of the invention.

In one embodiment the personal care composition is a skincare product. In one embodiment the personal care composition is a haircare product. In one embodiment the personal care composition is a dentrifice product. In one embodiment the personal care composition is a perfumery product. In one embodiment the personal care composition is a deodorant product. In one embodiment the personal care composition is an anti-perspirant product. In one embodiment the personal care composition is a soap. In one embodiment the personal care composition is a liquid soap. In one embodiment the personal care composition is a cream. In one embodiment the personal care composition is a lotion. In one embodiment the personal care composition is a gel. In one embodiment the personal care composition is a powder.

The invention also relates to a peptide of the invention for use in treatment or prevention of inflammation in a mammal.

The invention also relates to a composition of peptides of the invention for use in treatment or prevention of inflammation in a mammal.

The invention also relates to a peptide of the invention for use in treatment or prevention of an inflammatory disorder in a mammal.

The invention also relates to a composition of peptides of the invention for use in treatment or prevention of an inflammatory disorder in a mammal.

In one embodiment the inflammation is symptomatic inflammation.

In one embodiment the inflammatory disorder is an inflammatory disorder of the joints. In one embodiment the inflammatory disorder is an inflammatory disorder of the cardiovascular system. In one embodiment the inflammatory disorder is an autoimmune disease. In one embodiment the inflammatory disorder is a lung and airway inflammatory disorder. In one embodiment the inflammatory disorder is an intestinal inflammatory disorder. In one embodiment the inflammatory disorder is dermatitis. In one embodiment the inflammatory disorder is acne vulgaris. In one embodiment the inflammatory disorder is psoriasis. In one embodiment the inflammatory disorder is rheumatoid arthritis. In one embodiment the inflammatory disorder is cardiovascular disease. In one embodiment the inflammatory disorder is atherosclerosis. In one embodiment the inflammatory disorder is Type I diabetes. In one embodiment the inflammatory disorder is Graves disease. In one embodiment the inflammatory disorder is Guillain-Barre disease. In one embodiment the inflammatory disorder is Lupus. In one embodiment the inflammatory disorder is Psoriatic arthritis. In one embodiment the inflammatory disorder is Ulcerative colitis. In one embodiment the inflammatory disorder is asthma. In one embodiment the inflammatory disorder is cystic fibrosis. In one embodiment the inflammatory disorder is COPD. In one embodiment the inflammatory disorder is emphysema. In one embodiment the inflammatory disorder is acute respiratory distress syndrome. In one embodiment the inflammatory disorder is colitis. In one embodiment the inflammatory disorder is inflammatory bowel disease.

The invention also relates to a peptide of the invention for use in treatment or prevention of pain in a mammal.

The invention also relates to a composition of peptides of the invention for use in treatment or prevention of pain in a mammal.

The invention also relates to a peptide of the invention for use in treatment or prevention of a metabolic disorder in a mammal.

The invention also relates to a composition of peptides of the invention for use in treatment or prevention of a metabolic disorder in a mammal.

In one embodiment, the metabolic disorder is pre-diabetes. In one embodiment, the metabolic disorder is diabetes. In one embodiment, the metabolic disorder is Type-1 diabetes. In one embodiment, the metabolic disorder is Type-2 diabetes. In one embodiment, the metabolic disorder is metabolic syndrome. In one embodiment, the metabolic disorder is obesity. In one embodiment, the metabolic disorder is diabetic dyslipidemia. In one embodiment, the metabolic disorder is hyperlipidemia. In one embodiment, the metabolic disorder is hypertension. In one embodiment, the metabolic disorder is hypertriglyceridemia. In one embodiment, the metabolic disorder is hyperfattyacidemia. In one embodiment, the metabolic disorder is hypercholerterolemia. In one embodiment, the metabolic disorder is hyperinsulinemia. In one embodiment, the metabolic disorder is MODY

The invention also relates to a peptide of the invention for use in maintaining or restoring gut health in a mammal.

The invention also relates to a composition of peptides of the invention for use in maintaining or restoring gut health in a mammal.

The invention also relates to a peptide of the invention for use in maintaining or restoring muscle health (for example lean tissue mass) in a mammal.

The invention also relates to a composition of peptides of the invention for use in maintaining or restoring muscle health (for example lean tissue mass) in in a mammal.

The invention also relates to a pharmaceutical composition comprising a peptide of the invention in combination with a pharmaceutically acceptable carrier.

The invention also relates to a pharmaceutical composition comprising a composition of peptides of the invention in combination with a pharmaceutically acceptable carrier.

Such peptides can be used in personal care, supplement, food and pharmaceutical products to treat and maintain healthy levels of inflammation throughout the body. The present invention meets the huge need for food-derived specific peptides and peptide compositions that reduces inflammation in a way that is able to be processed by the body without completely blocking the immune response and causing autoimmune issues and other undesirable side effects. The invention is ultimately helping the 2 billion people suffering from inflammation.

The invention also relates to a comestible product, for example a food product comprising a composition of the invention, for example a dairy or non-dairy product, a solid food or a beverage, a food additive or supplement. The dairy product may be a milk, a cheese, or yoghurt. In one embodiment, the food product is a snack bar. The food product may comprise any amount of the composition of the invention, for example from 0.1% to 30% (w/w).

The peptides of the invention are used in the topical cosmetic or pharmaceutical composition of this invention at cosmetically or pharmaceutically effective concentrations to achieve the desired effect; in a preferred form with regards to the total weight of the composition, between 0.00000001% (in weight) and 20% (in weight); preferably between 0.000001% (in weight) and 15% (in weight), more preferably between 0.0001% (in weight) and 10% (in weight) and even more preferably between 0.0001% (in weight) and 5% (in weight). Ideally, the peptides of the present invention are preferably used from about 0.00001% w/w to about 0.5% w/w [0.1 to 5000 ppm], and more preferably from 0.00005 w/w to about 0.05 w/w [0.5 to 500 ppm], and most preferably from about 0.0001 w/w to about 0.01 w/w of the composition [1 to 100 ppm]. Ideally, the peptides of the present invention are preferably used from about 0.0001% w/w to about 0.004% w/w of the composition.

For compositions of peptides of the invention, a typical daily dosage may be 0.2 g to 100 g.

The dosage of compositions of the invention for use in food products and food supplements (i.e. comestible compositions) will be broadly in the 0.2-100 g/day range. In one embodiment, the daily dosage is 1-10 g/day, ideally about 3-8 g/day. In one embodiment, the daily dosage is 10-20 g/day. In one embodiment, the daily dosage is 20-30 g/day. In one embodiment, the daily dosage is 30-40 g/day. In one embodiment, the daily dosage is 10-100 g/day. In one embodiment, the daily dosage is about 5 g/day, ideally about 3-8 g/day. In one embodiment, the dosage is 2-1000 mg/day/kg body weight. In one embodiment, the dosage is 10-500 mg/day/kg body weight. In one embodiment, the dosage is 10-100 mg/day/kg body weight. In one embodiment, the dosage is 30-70 mg/day/kg body weight. The dosage of peptides of the invention for food supplements may be 0.00001 mg-0.01 mg per day or dose.

The food product may be a Food for Specific Medicinal Purposes (FSMP) which is defined as foods that are specifically formulated, processed and intended for the dietary management of diseases, disorders or medical conditions of individuals who are being treated under medical supervision. These foods are intended for the exclusive or partial feeding of people whose nutritional requirements cannot be met by normal foods. The dose may be 50-500 g per day depending on the age and condition of the patient. When administered as a food for special medicinal purpose, or medical food, the daily dosage may be 50-500 g per day.

The peptides and compositions of the invention may also be employed in the non-therapeutic treatment of inflammation. Examples of non-therapeutic treatment of inflammation include use to relieve normal, non-pathological, inflammation, for example inflammation in the muscles and joints following exercise.

The invention also provides topical composition comprising a peptide of the invention. It will be appreciated that the topical composition may comprise a plurality of peptides, fragments and/or variants. In one embodiment, the topical composition comprises substantially all the peptides. In one embodiment, the topical composition comprises substantially all the variants. The topical composition of the invention may be presented in a formulation selected from the group comprising creams, multiple emulsions, anhydrous compositions, aqueous dispersions, oils, milks, balsams, foams, lotions, gels, cream gels, hydro-alcoholic solutions, hydro-glycolic solutions, cosmetic, personal care product, hydrogels, liniments, sera, soaps, dusting powder, paste, semi solid formulations, liniments, serums, shampoo, conditioner, ointments, any rinse off formulation, talc, mousses, powders, sprays, aerosols, solutions, suspensions, emulsions, syrups, elixirs, polysaccharide films, patches, gel patches, bandages, an adhesive system, water-in-oil emulsions, oil-in-water emulsions, and silicone emulsions.

In an embodiment of the current invention, the emulsion contains a lipid or oil. The emulsion may be, but is not limited to, oil-in-water, water-in-oil, water-in-oil-in-water and oil-in-water-in-silcone emulsions. The emulsion may contain a humectant. The emulsion may contain an anti-foaming agent, such as silicone. The emulsion may have any suitable viscosity. Emulsions may further contain an emulsifier and/or an anti-foaming agent. Methods of preparing an emulsion are known to a person skilled in the art.

The topical composition of the invention may be incorporated into a medical device for administration. Such a device can include but is not limited to a fabric, patch, bandage, gauge, sock, tight, underwear, dressing, glove, mask, adhesive patches, non-adhesive patches, occlusive patches and microelectric patches or suitable adhesive system. In such an embodiment, the device is in direct contact with the keratinous layer such as the skin, thus releasing the peptides of the invention. It will be understood that the topical composition may be incorporated in any suitable form as detailed herein. For example, the topical composition or peptides of the invention can be incorporated into the device or be present on the surface of the device or can be in a cream, gel or wax formulation or any suitable formulation defined herein and incorporated into the device or on the surface of the device. The device may be adapted for adhesion or attachment to the skin.

In one embodiment the device is adapted to release a constant quantity of the composition or the peptides of the invention. It will be understood that the amount of the composition contained in the sustained release system will depend, for example, on where the composition is to be administered, the kinetics and duration of the release of the composition of the invention, as well as the nature of the condition, disorder and/or disease to be treated and/or cared for. The device may be such that the composition is released by biodegradation of the device, or by friction between the device and the body, due to bodily moisture, the skin's pH or body temperature.

In an embodiment of the invention the topical composition may further comprise at least one cosmetically or pharmaceutically acceptable excipient. Excipient may be used interchangeably with functional ingredient or additive. It will be understood that although the topical compositions of the current invention can be administered alone, they will generally be administered in admixture with a cosmetic or pharmaceutical excipient. Cosmetically or pharmaceutically acceptable excipient are well known in the art and any known excipient, may be used provided that it is suitable for topical administration and is dermatologically acceptable without undue toxicity, incompatibility and/or allergic reaction.

Preferably any excipient included is present in trace amounts. The amount of excipient included will depend on numerous factors, including the type of excipient used, the nature of the excipient, the component(s) of the topical composition, the amount of active or peptide in the topical composition and/or the intended use of the topical composition. The nature and amount of any excipient should not unacceptably alter the benefits of the peptides of this invention.

In an embodiment of the invention the excipient may be a suitable diluent, carrier, binder, lubricant, suspending agent, coating agent, preservative, stabilisers, dyes, vehicle, solubilising agent, base, emollient, emulsifying agent, fragrance, humectant, and/or surfactants.

Examples of suitable diluents include, but are not limited to, any diluent disclosed in disclosed in US2014120131 or US2004132667. Examples include ethanol, glycerol and water.

Examples of suitable carriers include, but are not limited to, lactose, starch, glucose, methyl cellulose, magnesium stearate, mannitol, sorbitol and any suitable carrier disclosed in US2014120131 or US2004132667.

Examples of suitable binders include, but are not limited to, starch, gelatin, natural sugars such as glucose, anhydrous lactose, free-flow lactose, beta-lactose, corn sweeteners, natural and synthetic gums, such as acacia, tragacanth or sodium alginate, carboxymethyl cellulose and polyethylene glycol and any suitable binder disclosed in US2014120131 or US2004132667.

Examples of suitable lubricants include, but are not limited to, sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, and sodium chloride and any suitable lubricant disclosed in US2014120131 or US2004132667.

The carrier may be any suitable carried known in the art or disclosed in US2014120131 or US2004132667. In some embodiments, the carrier may include, but is not limited to, a liquid, such as water, oils or surfactants, including those of petroleum, animal, plant or synthetic origin, polymer, oil, such as peanut oil, mineral oil, castor oil, soybean oil, alcohol, polysorbates, sorbitan esters, ether sulfates, sulfates, betaines, glycosides, maltosides, fatty alcohols, nonoxynols, poloxamers, polyoxyethylenes, polyethylene glycols, dextrose, glycerol, or digitonin. It will be understood that the carrier will be dermatologically acceptable. Preferred carriers contain an emulsion such as oil-in-water, water-in-oil, water-in-oil-in-water and oil-in-water-in-silicone emulsions. Emulsions may further contain an emulsifier and/or an anti-foaming agent.

In an embodiment of the invention, the topical composition may further comprise one or more additional ingredients. The topical composition of the invention may be administered consecutively, simultaneously or sequentially with the one or more other additional agents. Such additional ingredients may be those of benefit to include in a topical composition, or of benefit depending on the intended use of the topical composition. The additional ingredient may be active or functional or both.

Examples of such additional ingredients include, but are not limited to, one or more of cleaning agents, conditioning agents, sunscreen, pigment, moisturiser, thickening agents, gelling agents, essential oil, astringents, pigments, anti-caking agent, anti-foaming agent, binders, additives, buffers, chelating agents, external analgesics, film formers or materials, bulking agents, polymers, opacifying agents, pH adjusters, propellants, reducing agents, sequestrants, skin bleaching and lightening agents, skin conditioning agents, aloe vera, healing agents, soothing agents, smoothing agents, pantothenic acid, treating agents, thickeners, vitamins. colourants, pharmaceuticals, antiseptic agents, antifoaming agents, buffering agents, astringents, polymers, pH adjuster, deodorant or any other dermatologically acceptable carrier or surfactant.

It is to be understood that additional ingredients listed may provide more than one benefit. The classification given herein is for clarity and convenience only and not intended to limit the additional ingredient to that particular application or category listed.

Any additional ingredients should be suitable for application to the skin without undue toxicity, incompatibility and/or allergic reaction.

In some embodiments, the additional ingredient has glucose transport activity or aids glucose transport activity. In some embodiments, the additional ingredient has anti-inflammatory activity or aids anti-inflammatory activity. In some embodiments, the additional ingredient has anti-aging activity or aids anti-aging activity. In some embodiments, the additional ingredient is for keratinous layer health and/or development, skin health and/or development, and/or muscle health, recovery and/or development. The active agent may be a pharmacological enhancer. Such active agents are known and available on the market. In such cases, the topical composition of the invention may be administered consecutively, simultaneously or sequentially with the one or more other active agents.

In some embodiments, the additional ingredient may be farnesol ([2E, 6E], -3, 7, 11,-trimethyl-2, 6, 10, dodecatrien-1-ol), phytantriol (3, 7, 11, 15, tetramethylhexadecane-1, 2, 3, -triol), desquamation actives, enzymes, enzyme inhibitors, enzyme activators, botanical extracts and marine extracts, anti-acne actives, anti-wrinkle or anti atrophy actives, anti-oxidant/radical scavengers, chelators, flavonoids, anti-inflammatory agents, anti-cellulite agents, topical anaesthetics, tanning actives, skin lightening agents, skin healing agents, bisabolol, antimicrobial or antifungal active, sunscreen actives, particulate material, conditioning agents, structuring agents, thickening agent,

The desquamation active may be any suitable agent that enhances the skin appearance or texture of the skin and is as disclosed in US2014120131 or US2004132667.

Examples of anti-acne actives are as disclosed in US2014120131 or US2004132667 and include, resorcinol, salicylic acid, erythromycin, zine, sulfur, benzoyl peroxides.

Examples of thickening agents are as disclosed in US2014120131 or US2004132667 and include carboxylic acid polymers, crosslinked polyacrylate polymers, polyacrylamide polymers, polysaccharides.

Examples of conditioning agents are as disclosed in US2014120131 or US2004132667 and include humectants, moisturiser or skin conditioner.

Examples of structuring agents are as disclosed in US2014120131 or US2004132667 and include any agent that provide rheological characteristics to the composition and contributes to the stability of the composition.

Any suitable antimicrobial or antifungal active may be used and examples are as disclosed in US2014120131 or US2004132667. Such actives are capable of destroying microbes, preventing growth or action of microbes. Examples include but are not limited to .beta.-lactam drugs, quinolone drugs, tetracycline, erythromycin, streptomycin sulfate, salicylic acid, benzoyl peroxide.

Examples of a particulate material include metallic oxide. Examples of anti-cellulite agents include xanthine agents. Examples of tanning actives includes 1, 3-dihydroxy-2-propanone and those disclosed in US2014120131 or US2004132667. Examples of topical anaesthetics include benzocaine, lidocaine and bupivacaine and those disclosed in US2014120131 or US2004132667.

Examples of skin lightening agents include any agent known in the art such as kojic acid, ascorbic acid and those disclosed in US2014120131 or US2004132667.

Examples of sunscreen actives include any suitable organic or inorganic sunscreen active. Examples include metallic oxides, 2-ethylhexyl-p-methoxycinnamate and those disclosed in US2014120131 or US2004132667.

Examples of skin healing agents includes panthenoic acid as disclosed in US2014120131 or US2004132667.

Examples of anti-inflammatory agents include any agent that enhances the skin appearance, tone or colour and include but are not limited to corticosteroids, hydrocortisone, non-steroidal agents such as ibuprofen and aspirin and those disclosed in US2014120131 or US2004132667.

Examples of flavonoids includes flavanones, methoxy flavonones, unsubstituted chalcone and mixtures thereof and those disclosed in US2014120131 or US2004132667.

Examples of enzymes include lipases, proteases, catalase, super oxide-dismutase, amylase, peroxidase, glucuronidase, ceramidases, hyaluronidases. Examples of enzyme inhibitors include trypsine inhibitors, Bowmann Birk inhibitors, chymotrypsin inhibitors, botanical extracts, flavonoids, quercetin chalcone and those disclosed in US2014120131 or US2004132667 and mixtures thereof. Examples of enzyme activators include coenzyme A, Q10 (ubiquinone), glycyrrhizin, berberine, chrysin and those disclosed in US2014120131 or US2004132667 and mixtures thereof

Examples of anti-wrinkle or anti atrophy actives include sulfur containing D and L amino acids, particular, N-acyl derivatives such as N-acetyl-L-cysteine, hydroxyl acids, phytic acid, lipoic acid, lysophosphatidic acid, skin peel agents, vitamin B.sub.3, retinoids and those disclosed in US2014120131 or US2004132667 and mixtures thereof.

The anti-oxidant/radical scavenger agent may be any agent that is useful for providing protection against UV radiation or other environmental agents which may cause skin damage such as those disclosed in US2014120131 or US2004132667. Examples of anti-oxidant/radical scavengers include ascorbic acid, its salts and derivatives (vitamin C), tocopherol its salts and derivatives (vitamin E), butylated hydroxyl benzoic acids and their salts, peroxides, gallic acids and alkyl esters, sorbic acid, lipoic acid, amines, lycine pidolate, arginine pilolate, nordihydroguaiaretic acid, bioflavonoids, curcumin, lysine, methionine, proline, superoxide dismutase, silymarin, tea extracts and mixtures thereof.

Examples of chelators include EDTA, NTA, hydoxamic acids, phytic acid, lactoferrin and those disclosed in US2014120131 or US2004132667 and mixtures thereof. A chelator means an agent capable of removing a metal ion by forming a complex so that the metal ion cannot participate in or catalyse chemical reactions. A chelator is useful for protection against UV radiation or other environmental agents that can cause skin damage.

It will be appreciated that a plurality of additional ingredients may be added. The amount of the additional ingredient may be from about 0.001% to about 50% weight of the composition, preferably, about 0.01% to about 20%, preferably about 0.1% to about 10%, about 0.5% to about 10%, about 1% to about 5%, preferably 2% weight of the composition. The amount of additional ingredient included will depend on numerous factors, including the type of additional ingredient used, the nature of the additional ingredient, the component(s) of the topical composition, the amount of active or peptide in the topical composition and/or the intended use of the topical composition. The nature and amount of any additional ingredient should not unacceptably alter the benefits of the peptides of this invention.

The topical composition may be alcohol free.

In some embodiments of the invention, the composition further comprises one or more additional active agents, in addition to the peptide of the invention (also known as the active of the composition). In addition, or alternatively, the composition may be administered with one or more other additional active agents. Typical said additional active agent is present in trace amounts only. In some embodiments, there may be no additional active agent present in the composition. The amount of additional active agent included will depend on numerous factors, including the type of additional active agent used, the nature of the additional active agent, the component(s) of the topical composition, the amount of active or peptide in the topical composition and/or the intended use of the topical composition. The nature and amount of any additional active agent should not unacceptably alter the benefits of the peptides of this invention.

It is to be understood that an ingredient that is considered to be an "active" ingredient in one product may be a "functional" or "excipient" ingredient in another and vice versa. It will also be appreciated that some ingredients play a dual role as both an active ingredient and as a functional or excipient ingredient.

Examples of the additional active agents include glucose transport promoting drugs, skin supplement, agent for treatment and/or care of the skin, anti-inflammatory agent, an anti-aging agent, a cellular growth promoting agent and pharmacological enhancers. Such agents are well known in the art and it will be appreciated that any suitable additional active agent may be used. Additional active agents for treatment and/or care of the skin may include collagen synthesis agents, retinoids, exfoliating agents, anti-cellulite agents, elastase inhibiting agents, melanin synthesis stimulating or inhibiting agents, self-tanning agents, antiaging agents, antimicrobial agents, antifungal agents, fungistatic agents, bactericidal agents, and healing agents. Active agents also include anti-inflammatory agents.

Any additional active agent should be suitable for application to the skin without undue toxicity, incompatibility and/or allergic reaction.

It will be understood that the classification given herein is for clarity and convenience only and not intended to limit the additional ingredient, excipient, or active to that particular application or category listed.

In a particularly preferred embodiment, the methods and uses of the invention involve administration of a peptide or composition of the invention in combination with one or more other active agents, for example, existing growth promoting drugs or pharmacological enhancers available on the market. In such cases, the compounds of the invention may be administered consecutively, simultaneously or sequentially with the one or more other active agents.

The effect of the current invention is accomplished by topical application or administration of the topical composition of the invention described herein to a person, animal or a patient in need of treatment or care. Topical delivery preferably means delivery to a keratinous layer such as the skin, hair and/or nails, but can also mean delivery to a body lumen lined with epithelial cells, for example the lungs or airways, the gastrointestinal tract, the buccal cavity. The effect may be confined to the surface of the skin or may be within the skin or a combination of both.

The topical composition of the invention is administered in a cosmetically or pharmaceutically effective amount. In other words, in an amount that is non-toxic but sufficient amount to provide the desired effect. It will be appreciated that a person skilled in the art would be capable of determining an appropriate dose of the topical compositions of the invention to administer without undue experimentation. Alternatively, a physician will determine the actual dose that is most suitable for a patient depending on the particular condition, disease or disorder to be treated or cared for and the age, body weight and/or health of the person. It will depend on a variety of factors including the activity of the specific compound employed, the metabolic stability and length of action of that compound, the age, body weight, general health, sex, diet, mode and time of administration, rate of excretion, drug combination, the severity of the particular condition, and the individual undergoing therapy. There can, of course, be individual instances where higher or lower dosage ranges are merited, and such are within the scope of this invention. For example, the composition may be administered at a dose of from 0.01 to 50 mg/kg body weight, such as from 0.1 to 30 mg/kg, more preferably from 0.1 to 20 mg/kg body weight, more preferably from 0.1 to 10 mg/kg body weight, preferably 0.1 to 5 mg/kg body weight. In an exemplary embodiment, one or more doses of 10 to 300 mg/day or more preferably, 10 to 150 mg/day, will be administered to the patient. The amount and the frequency is as best suited to the purpose. The frequency of application or administration can vary greatly, depending on the needs of each subject, with a recommendation of an application or administration range from once a month to ten times a day, preferably from once a week to four times a day, more preferably from three times a week to three times a day, even more preferably once or twice a day.

In preferred embodiments, repeated use of the topical composition is provided.

The topical composition may be applied by, but not limited to, rubbing, or massaging into the keratinous tissue, skin or area of the body to be treated or cared for. In some embodiments, the composition is left on or not removed from the area of the body. In other embodiments, the composition is removed after a period of time, such as, but not limited to, from about 2 minutes to 60 minutes, from about 5 minutes to about 30 minutes, preferably from about 10 minutes to about 20 minutes. The composition may be removed immediately after application. In some embodiments of the current invention, the composition of the invention may be applied to an area to be treated by means to achieve a greater penetration of the composition and/or peptide of the invention, such as, but not limited to, iontophoresis, sonophoresis, electroporation, microelectric patches, mechanical pressure, osmotic pressure gradient, occlusive cure, microinjections or needle-free injections by means of pressure, such as injections by oxygen pressure, or any combination thereof.

The peptides of the invention are used in the topical cosmetic or pharmaceutical composition of this invention at cosmetically or pharmaceutically effective concentrations to achieve the desired effect; in a preferred form with regards to the total weight of the composition, between 0.00000001% (in weight) and 20% (in weight); preferably between 0.000001% (in weight) and 15% (in weight), more preferably between 0.0001% (in weight) and 10% (in weight) and even more preferably between 0.0001% (in weight) and 5% (in weight).

In some embodiments of the current invention, the composition may be delivered via any one of liposomes, mixed liposomes, oleosomes, niosomes, ethosomes, millicapsules, capsules, macrocapsules, nanocapsules, nanostructured lipid carriers, sponges, cyclodextrins, vesicles, micelles, mixed micelles of surfactants, surfactant-phospholipid mixed micelles, milli spheres, spheres, lipospheres, particles, nanospheres, nanoparticles, milliparticles, solid nanopartciles as well as microemulsions including water-in-oil microemulsions with an internal structure of reverse micelle and nanoemulsions microspheres, microparticles.

A variety of methods are available for preparing liposomes. See, e.g., Szoka et al., Ann. Rev. Biophys. Bioeng. 9:467 (1980), U.S. Pat. Nos. 4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, 4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, 4,946,787, PCT Publication No. WO 91/17424, Deamer & Bangham, Biochim. Biophys. Acta 443:629-634 (1976); Fraley, et al., PNAS 76:3348-3352 (1979); Hope et al., Biochim. Biophys. Acta 812:55-65 (1985); Mayer et al., Biochim. Biophys. Acta 858:161-168 (1986); Williams et al., PNAS 85:242-246 (1988); Liposomes (Ostro (ed.), 1983, Chapter 1); Hope et al., Chem. Phys. Lip. 40:89 (1986); Gregoriadis, Liposome Technology (1984) and Lasic, Liposomes: from Physics to Applications (1993)). Suitable methods include, for example, sonication, extrusion, high pressure/homogenization, microfluidization, detergent dialysis, calcium-induced fusion of small liposome vehicles and ether fusion methods, all of which are well known in the art.

These delivery systems may be adapted to achieve a greater penetration of the compound and/or peptides of the invention. This may improve pharmacokinetic and pharmacodynamics properties. The delivery system may be a sustained release system wherein the compound or peptide of the invention is gradually released during a period of time and preferably with a constant release rate over a period of time. The delivery systems are prepared by methods known in the art. The amount of peptide contained in the sustained release system will depend on where the composition is to be delivered and the duration of the release as well as the type of the condition, disease and/or disorder to be treated or cared for.

The topical composition of the invention may be for human or animal usage in human and veterinary medicine.

The topical composition of the invention may be used for pharmaceutical, personal care and/or cosmetic uses.

The composition can be used to treat or care for any disease, disorder or condition of the skin, including but not limited to, psoriasis, dermatitis, allergic dermatitis, eczema, spongiosis, edema, skin cancer, ulcers, acne, scars, cellulitis, elastosis, keratosis, rosacea, varicose veins, inflammatory disorders.

The topical composition may be used to for treating or caring for visible signs of aging including but not limited to wrinkles, stretch marks and dark circles, dryness, fine lines, age spots, red blotches, sagging skin, and conditions caused by sun exposure including sunburn, stress, pollution and/diet. The topical composition may also be used for delaying, slowing or inhibiting the skins or the onset of aging. The composition may be administered by a medical device, such as a plaster or a patch as described herein.

The topical composition may be used to treat or care for a wound in a mammal. In another embodiment, the topical composition is for use in the treatment or prevention of a disease or condition characterised by damaged epithelial cells or tissue, and/or damaged dermal or epithelial cells or tissue. The disease may be but is not limited to cancer and trauma.

The topical composition may be used to treat or care for any muscle condition, to improve, muscle status in a mammal, to promote recovery of muscle, typically following exercise, to maintain or restore muscle health (for example lean tissue mass) in a mammal, to enhance physical performance, in treatment or prevention of a disease or condition characterised by lethargy or low energy levels.

The topical composition may be used to promote growth of a tissue, promote growth of epithelial tissue, promote growth of skin, promote growth of an organ, promote growth of an organism. The skin can have a normal pathology and/or an abnormal pathology.

The topical composition may also be used to treat or care for any inflammatory disorder.

A further aspect of the invention relates to a pharmaceutical composition comprising a peptide of the invention or a composition of peptides of the invention, admixed with one or more pharmaceutically acceptable diluents, excipients or carriers. Even though the peptides and compositions of the present invention can be administered alone, they will generally be administered in admixture with a pharmaceutical carrier, excipient or diluent, particularly for human therapy. The pharmaceutical compositions may be for human or animal usage in human and veterinary medicine. Examples of such suitable excipients for the various different forms of pharmaceutical compositions described herein may be found in the "Handbook of Pharmaceutical Excipients, 2.sup.nd Edition, (1994), Edited by A Wade and P J Weller. In particular, formulations for topical delivery are described in Topical drug delivery formulations edited by David Osborne and Antonio Aman, Taylor & Francis, the complete contents of which are incorporated herein by reference. Acceptable carriers or diluents for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985). Examples of suitable carriers include lactose, starch, glucose, methyl cellulose, magnesium stearate, mannitol, sorbitol and the like. Examples of suitable diluents include ethanol, glycerol and water. The choice of pharmaceutical carrier, excipient or diluent can be selected with regard to the intended route of administration and standard pharmaceutical practice. The pharmaceutical compositions may comprise as, or in addition to, the carrier, excipient or diluent any suitable binder(s), lubricant(s), suspending agent(s), coating agent(s), solubilising agent(s). Examples of suitable binders include starch, gelatin, natural sugars such as glucose, anhydrous lactose, free-flow lactose, beta-lactose, corn sweeteners, natural and synthetic gums, such as acacia, tragacanth or sodium alginate, carboxymethyl cellulose and polyethylene glycol. Examples of suitable lubricants include sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride and the like. Preservatives, stabilizers, dyes and even flavouring agents may be provided in the pharmaceutical composition. Examples of preservatives include sodium benzoate, sorbic acid and esters of p-hydroxybenzoic acid. Antioxidants and suspending agents may be also used.

The peptide or composition of the invention may be adapted for topical, oral, rectal, parenteral, intramuscular, intraperitoneal, intra-arterial, intrabronchial, subcutaneous, intradermal, intravenous, nasal, vaginal, buccal or sublingual routes of administration. For oral administration, particular use is made of compressed tablets, pills, tablets, gellules, drops, and capsules. Preferably, these compositions contain from 1 to 250 mg and more preferably from 10-100 mg, of active ingredient per dose. Other forms of administration comprise solutions or emulsions which may be injected intravenously, intra-arterial, subcutaneously, intradermally, intraperitoneally or intramuscularly, and which are prepared from sterile or sterilisable solutions. The pharmaceutical compositions of the present invention may also be in form of suppositories, vaginal rings, pessaries, suspensions, emulsions, lotions, ointments, creams, gels, sprays, solutions or dusting powders. The composition of the invention may be formulated for topical delivery. Topical delivery generally means delivery to the skin, but can also mean delivery to a body lumen lined with epithelial cells, for example the lungs or airways, the gastrointestinal tract, the buccal cavity. In particular, formulations for topical delivery are described in Topical drug delivery formulations edited by David Osborne and Antonio Aman, Taylor & Francis, the complete contents of which are incorporated herein by reference. Compositions or formulations for delivery to the airways are described in O'Riordan et al (Respir Care, 2002, November 47), EP2050437, WO2005023290, US2010098660, and US20070053845. Composition and formulations for delivering active agents to the iluem, especially the proximal iluem, include microparticles and microencapsulates where the active agent is encapsulated within a protecting matrix formed of polymer or dairy protein that is acid resistant but prone to dissolution in the more alkaline environment of the ileum. Examples of such delivery systems are described in EP1072600.2 and EP13171757.1. An alternative means of transdermal administration is by use of a skin patch. For example, the active ingredient can be incorporated into a cream consisting of an aqueous emulsion of polyethylene glycols or liquid paraffin. The active ingredient can also be incorporated, at a concentration of between 1 and 10% by weight, into an ointment consisting of a white wax or white soft paraffin base together with such stabilisers and preservatives as may be required.

Injectable forms may contain between 10-1000 mg, preferably between 10-250 mg, of active ingredient per dose.

Compositions may be formulated in unit dosage form, i.e., in the form of discrete portions containing a unit dose, or a multiple or sub-unit of a unit dose.

A person of ordinary skill in the art can easily determine an appropriate dose of one of the instant compositions to administer to a subject without undue experimentation. Typically, a physician will determine the actual dosage which will be most suitable for an individual patient and it will depend on a variety of factors including the activity of the specific compound employed, the metabolic stability and length of action of that compound, the age, body weight, general health, sex, diet, mode and time of administration, rate of excretion, drug combination, the severity of the particular condition, and the individual undergoing therapy. The dosages disclosed herein are exemplary of the average case. There can of course be individual instances where higher or lower dosage ranges are merited, and such are within the scope of this invention. Depending upon the need, the agent may be administered at a dose of from 0.01 to 30 mg/kg body weight, such as from 0.1 to 10 mg/kg, more preferably from 0.1 to 1 mg/kg body weight. In an exemplary embodiment, one or more doses of 10 to 300 mg/day or more preferably, 10 to 150 mg/day, will be administered to the patient for the treatment of an inflammatory disorder.

In a particularly preferred embodiment, the methods and uses of the invention involve administration of a peptide or composition of the invention in combination with one or more other active agents, for example, existing anti-inflammatory drugs or pharmacological enhancers available on the market. In such cases, the compounds of the invention may be administered consecutively, simultaneously or sequentially with the one or more other active agents.

In one embodiment of the invention, the peptide of the invention may be administered in the form of a conjugate comprising the peptide, and may optionally include a linker, and a partner molecule, for example a protein such as an antibody molecule intended to increase the half-life of the conjugate in-vivo. In one embodiment, the peptide may be modified to substitute one or more amino acids with amino acids employed to attach partner molecules. For example, an amino acid may be substituted with a lysine residue for the purpose of conjugating a partner molecule such as a PEG molecule.

Definitions

All publications, patents, patent applications and other references mentioned herein are hereby incorporated by reference in their entireties for all purposes as if each individual publication, patent or patent application were specifically and individually indicated to be incorporated by reference and the content thereof recited in full.

Where used herein and unless specifically indicated otherwise, the following terms are intended to have the following meanings in addition to any broader (or narrower) meanings the terms might enjoy in the art:

Unless otherwise required by context, the use herein of the singular is to be read to include the plural and vice versa. The term "a" or "an" used in relation to an entity is to be read to refer to one or more of that entity. As such, the terms "a" (or "an"), "one or more," and "at least one" are used interchangeably herein.

As used herein, the term "comprise," or variations thereof such as "comprises" or "comprising," are to be read to indicate the inclusion of any recited integer (e.g. a feature, element, characteristic, property, method/process step or limitation) or group of integers (e.g. features, element, characteristics, properties, method/process steps or limitations) but not the exclusion of any other integer or group of integers. Thus, as used herein the term "comprising" is inclusive or open-ended and does not exclude additional, unrecited integers or method/process steps.

As used herein, the term "disease" is used to define any abnormal condition that impairs physiological function and is associated with specific symptoms. The term is used broadly to encompass any disorder, illness, abnormality, pathology, sickness, condition or syndrome in which physiological function is impaired irrespective of the nature of the aetiology (or indeed whether the aetiological basis for the disease is established). It therefore encompasses conditions arising from infection, trauma, injury, surgery, radiological ablation, poisoning or nutritional deficiencies.

As used herein, the term "treatment" or "treating" refers to an intervention (e.g. the administration of an agent to a subject) which cures, ameliorates or lessens the symptoms of a disease or removes (or lessens the impact of) its cause(s) (for example, the reduction in accumulation of pathological levels of lysosomal enzymes). In this case, the term is used synonymously with the term "therapy".

Additionally, the terms "treatment" or "treating" refers to an intervention (e.g. the administration of an agent to a subject) which prevents or delays the onset or progression of a disease or reduces (or eradicates) its incidence within a treated population. In this case, the term treatment is used synonymously with the term "prophylaxis".

As used herein, an effective amount or a therapeutically effective amount of an agent defines an amount that can be administered to a subject without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio, but one that is sufficient to provide the desired effect, e.g. the treatment or prophylaxis manifested by a permanent or temporary improvement in the subject's condition. The amount will vary from subject to subject, depending on the age and general condition of the individual, mode of administration and other factors. Thus, while it is not possible to specify an exact effective amount, those skilled in the art will be able to determine an appropriate "effective" amount in any individual case using routine experimentation and background general knowledge. A therapeutic result in this context includes eradication or lessening of symptoms, reduced pain or discomfort, prolonged survival, improved mobility and other markers of clinical improvement. A therapeutic result need not be a complete cure.

The term "mammal" should be understood to mean a higher mammal, especially a human. However, the term also includes non-mammalian animals such as fish.

The term "peptide" used herein refers to a polymer composed of up to 50 amino acid monomers typically via peptide bond linkage. The peptide may be 3-50 amino acids in length. The peptide may be 4 to 50 amino acids in length. The peptide may be 5-50 amino acids in length. The peptide may be 7 to 50 amino acids in length. Peptides (including fragments and variants thereof) of and for use in the invention may be generated wholly or partly by chemical synthesis or by expression from nucleic acid. For example, the peptides of and for use in the present invention can be readily prepared according to well-established, standard liquid or, preferably, solid-phase peptide synthesis methods known in the art (see, for example, J. M. Stewart and J. D. Young, Solid Phase Peptide Synthesis, 2nd edition, Pierce Chemical Company, Rockford, Ill. (1984), in M. Bodanzsky and A. Bodanzsky, The Practice of Peptide Synthesis, Springer Verlag, New York (1984). When necessary, any of the peptides employed in the invention can be chemically modified to increase their stability. A chemically modified peptide or a peptide analog includes any functional chemical equivalent of the peptide characterized by its increased stability and/or efficacy in vivo or in vitro in respect of the practice of the invention. The term peptide analog also refers to any amino acid derivative of a peptide as described herein. A peptide analog can be produced by procedures that include, but are not limited to, modifications to side chains, incorporation of unnatural amino acids and/or their derivatives during peptide synthesis and the use of cross-linkers and other methods that impose conformational constraint on the peptides or their analogs. Examples of side chain modifications include modification of amino groups, such as by reductive alkylation by reaction with an aldehyde followed by reduction with NaBH.sub.4; amidation with methylacetimidate; acetylation with acetic anhydride; carbamylation of amino groups with cyanate; trinitrobenzylation of amino groups with 2, 4, 6, trinitrobenzene sulfonic acid (TNBS); alkylation of amino groups with succinic anhydride and tetrahydrophthalic anhydride; and pyridoxylation of lysine with pyridoxa-5'-phosphate followed by reduction with NABH.sub.4. The guanidino group of arginine residues may be modified by the formation of heterocyclic condensation products with reagents such as 2,3-butanedione, phenylglyoxal and glyoxal. The carboxyl group may be modified by carbodiimide activation via o-acylisourea formation followed by subsequent derivatization, for example, to a corresponding amide. Sulfhydryl groups may be modified by methods, such as carboxymethylation with iodoacetic acid or iodoacetamide; performic acid oxidation to cysteic acid; formation of mixed disulphides with other thiol compounds; reaction with maleimide; maleic anhydride or other substituted maleimide; formation of mercurial derivatives using 4-chloromercuribenzoate, 4-chloromercuriphenylsulfonic acid, phenylmercury chloride, 2-chloromercuric-4-nitrophenol and other mercurials; carbamylation with cyanate at alkaline pH. Tryptophan residues may be modified by, for example, oxidation with N-bromosuccinimide or alkylation of the indole ring with 2-hydroxy-5-nitrobenzyl bromide or sulphonyl halides. Tryosine residues may be altered by nitration with tetranitromethane to form a 3-nitrotyrosine derivative. Modification of the imidazole ring of a histidine residue may be accomplished by alkylation with iodoacetic acid derivatives or N-carbethoxylation with diethylpyrocarbonate. Examples of incorporating unnatural amino acids and derivatives during peptide synthesis include, but are not limited to, use of norleucine, 4-amino butyric acid, 4-amino-3-hydroxy-5-phenylpentanoic acid, 6-aminohexanoic acid, t-butylglycine, norvaline, phenylglycine, ornithine, sarcosine, 4-amino-3-hydroxy-6-methylheptanoic acid, 2-thienyl alanine and/or D-isomers of amino acids. Peptide structure modification includes the generation of retro-inverso peptides comprising the reversed sequence encoded by D-amino acids.

"Modified peptide": In an embodiment of the invention the peptide is a modified peptide. The term modified peptide is used interchangeably with the term derivative of the peptide. The modified peptide includes a peptide which has been substituted with one or more groups as defined herein. The modification may be any modified that provides the peptides and or the composition of the invention with an increased ability to penetrate a cell. The modification may be any modification that increases the half-life of the composition or peptides of the invention. In one embodiment, the group is a protecting group. The protecting group may be an N-terminal protecting group, a C-terminal protecting group or a side-chain protecting group. The peptide may have one or more of these protecting groups. The person skilled in the art is aware of suitable techniques to react amino acids with these protecting groups. These groups can be added by preparation methods known in the art, for example the methods as outlined in paragraphs [0104] to [0107] of US2014120141. The groups may remain on the peptide or may be removed. The protecting group may be added during synthesis. In an embodiment of the invention the peptides may be substituted with a group selected from one or more straight chain or branched chain, long or short chain, saturated, or unsaturated, substituted with a hydroxyl, amino, amino acyl, sulfate or sulphide group or unsubstituted having from 1 to 29 carbon atoms. N-acyl derivatives include acyl groups derived from acetic acid, capric acid, lauric acid, myristic acid, octanoic acid, palmitic acid, stearic acid, behenic acid, linoleic acid, linolenic acid, lipoic acid, oleic acid, isosteric acid, elaidoic acid, 2-ethylhexaneic acid, coconut oil fatty acid, tallow fatty acid, hardened tallow fatty acid, palm kernel fatty acid, lanolin fatty acid or similar acids. These may be substituted or unsubstituted. When substituted they are preferably substituted with hydroxyl, or sulphur containing groups such as but not limited to SO.sub.3H, SH, or S--S. In an embodiment of the current invention, the peptide is R.sub.1--X--R.sub.2. R.sub.1 and/or R.sub.2 groups respectively bound to the amino-terminal (N-terminal) and carboxyl-terminal (C-terminal) of the peptide sequence. In one embodiment, the peptide is R.sub.1--X. Alternatively, the peptide is X-- R.sub.2. Preferably, R.sub.1 is H, C.sub.1-4 alkyl, acetyl, benzoyl or trifluoroacetyl; X is the peptide of the invention; R.sub.2 is OH or NH.sub.2. In an embodiment, R.sub.1 is selected from the group formed by H, a non-cyclic substituted or unsubstituted aliphatic group, substituted or unsubstituted alicyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted heteroarylalkyl, substituted or unsubstituted aryl, substituted or unsubstituted aralkyl, Tert-butyloxycarbonyl, 9-fluorenylmethyloxycarbonyl (Fmoc) and R.sub.5--CO--, wherein R.sub.5 is selected from the group formed by H, a non-cyclic substituted or unsubstituted aliphatic group, substituted or unsubstituted alicyclyl, substituted or unsubstituted aryl, substituted or unsubstituted aralkyl, substituted or unsubstituted heterocyclyl and substituted or unsubstituted heteroarylalkyl; R.sub.2 is selected from the group formed by --NR.sub.3R.sub.4, --OR.sub.3 and --SR.sub.3, wherein R.sub.3 and R.sub.4 are independently selected from the group formed by H, a non-cyclic substituted or unsubstituted aliphatic group, substituted or unsubstituted alicyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted heteroarylalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted aralkyl; and with the condition that R.sub.1 and R.sub.2 are not .alpha.-amino acids. In accordance with another preferred embodiment, R.sub.2 is --NR.sub.3R.sub.4, --OR.sub.3 or --SR.sub.3 wherein R.sub.3 and R.sub.4 are independently selected from the group formed by H, substituted or unsubstituted C.sub.1-C.sub.24 alkyl, substituted or unsubstituted C.sub.2-C.sub.24 alkenyl, Tert-butyloxycarbonyl, 9-fluorenylmethyloxycarbonyl (Fmoc), substituted or unsubstituted C.sub.2-C.sub.24 alkynyl, substituted or unsubstituted C.sub.3-C.sub.24 cycloalkyl, substituted or unsubstituted C.sub.5-C.sub.24 cycloalkenyl, substituted or unsubstituted C.sub.8-C.sub.24 cycloalkynyl, substituted or unsubstituted C.sub.6-C.sub.30 aryl, substituted or unsubstituted C.sub.7-C.sub.24 aralkyl, substituted or unsubstituted heterocyclyl ring of 3-10 members, and substituted or unsubstituted heteroarylalkyl of 2 to 24 carbon atoms and 1 to 3 atoms other than carbon wherein the alkyl chain is of 1 to 6 carbon atoms. Optionally, R.sub.3 and R.sub.4 can be bound by a saturated or unsaturated carbon-carbon bond, forming a cycle with the nitrogen atom. More preferably R.sub.2 is --NR.sub.3R.sub.4 or --OR.sub.3, wherein R.sub.3 and R.sub.4 are independently selected from the group formed by H, substituted or unsubstituted C.sub.1-C.sub.24 alkyl, substituted or unsubstituted C.sub.2-C.sub.24 alkenyl, substituted or unsubstituted C.sub.2-C.sub.24 alkynyl, substituted or unsubstituted C.sub.3-C.sub.10 cycloalkyl, substituted or unsubstituted C.sub.6-C.sub.15 aryl and substituted or unsubstituted heterocyclyl of 3-10 members, substituted or unsubstituted heteroarylalkyl with a ring of 3 to 10 members and an alkyl chain of 1 to 6 carbon atoms. More preferably R.sub.3 and R.sub.4 are selected from the group formed by H, methyl, ethyl, hexyl, dodecyl, or hexadecyl. Even more preferably R.sub.3 is H and R.sub.4 is selected from the group formed by H, methyl, ethyl, hexyl, dodecyl, or hexadecyl. In accordance with an even more preferred embodiment, R.sub.2 is selected from --OH and --NH.sub.2. In accordance with another embodiment of this invention R.sub.1 is selected from the group formed by H, acetyl, lauroyl, myristoyl or palmitoyl, and R.sub.2 is --NR.sub.3R.sub.4 or --OR.sub.3 wherein R.sub.3 and R.sub.4 are independently selected from H, methyl, ethyl, hexyl, dodecyl and hexadecyl, preferably R.sub.2 is --OH or --NH.sub.2. More preferably, R.sub.1 is acetyl or palmitoyl and R.sub.2 is --NH.sub.2. In a preferred embodiment, the acyl group is bound to the N-terminal end of at least one amino acid of the peptide. In an embodiment of the invention, the peptide is modified to comprise a side chain protecting group. The side chain protecting group may be one or more of the group comprising benzyl or benzyl based groups, t-butyl-based groups, benzyloxy-carbonyl (Z) group, and allyloxycarbonyl (alloc) protecting group. The side chain protecting group may be derived from an achiral amino acid such as achiral glycine. The use of an achiral amino acid helps to stabilise the resultant peptide and also facilitate the facile synthesis route of the present invention. Preferably, the peptide further comprises a modified C-terminus, preferably an amidated C-terminus. The achiral residue may be alpha-aminoisobutyric acid (methylalaine). It will be appreciated that the specific side chain protecting groups used will depend on the sequence of the peptide and the type of N-terminal protecting group used.

"Conjugate": In one embodiment of the invention the peptide is conjugated, linked or fused to a binding partner, for example one or more polyethylene glycol polymers or other compounds, such as molecular weight increasing compounds or lipophilic groups. The molecular weight increasing compound is any compound that will increase the molecular weight, typically by 10% to 90%, or 20% to 50% of the resulting conjugate and may have a molecular weight of between 200 and 20, 000, preferably between 500 and 10, 000. The molecular weight increasing compound may be PEG, any water-soluble (amphiphilic or hydrophilic) polymer moiety, homo or co-polymers of PEG, a monomethyl-substituted polymer of PEG (mPEG) and polyoxyethylene glycerol (POG), polyamino acids such as poly-lysine, poly-glutamic acid, poly-aspartic acid, particular those of L conformation, pharmacologically inactive proteins such as albumin, gelatin, a fatty acid, olysaccharide, a lipid amino acid and dextran. The polymer moiety may be straight chained or branched and it may have a molecular weight of 500 to 40000 Da, 5000 to 10000 Da, 10000 to 5000, Da. The compound (binding partner) may be any suitable cell penetrating compound, such as that peptide, penetratin, pep-1. The compound (binding partner) may be an antibody molecule. The compound (binding partner) may be a lipophilic moiety or a polymeric moiety. The lipophilic substituent and polymeric substituents are known in the art. The lipophilic substituent includes an acyl group, a sulphonyl group, an N atom, an O atom or an S atom which forms part of the ester, sulphonyl ester, thioester, amide or sulphonamide. The lipophilic moiety may include a hydrocarbon chain having 4 to 30 C atoms, preferably between 8 and 12 C atoms. It may be linear or branched, saturated or unsaturated. The hydrocarbon chain may be further substituted. It may be cycloalkane or heterocycloalkane. The peptide may be modified at the N-terminal, C-terminal or both. The polymer or compound (binding partner) is preferably linked to an amino, carboxyl or thio group and may be linked by N-termini or C-termini of side chains of any amino acid residue. The polymer or compound (binding partner) may be conjugated to the side chain of any suitable residue. The polymer or compound (binding partner) may be conjugated via a spacer. The spacer may be a natural or unnatural amino acid, succinic acid, lysyl, glutamyl, asparagyl, glycyl, beta-alanyl, gamma-amino butanoyl. The polymer or compound (binding partner) may be conjugated via an ester, a sulphonyl ester, a thioester, an amide, a carbamate, a urea, a sulphonamide. A person skilled in the art is aware of suitable means to prepare the described conjugate.

"Fragment" means a segment of a protein, typically selected from SEQ ID Nos: 1 to 16 and 353-355, and particularly from a region of those proteins selected SEQ ID NOS: 17 to 70. In one embodiment, the fragment is typically 3 to 37 contiguous amino acids in length. In one embodiment, the fragment is typically 5 to 37 contiguous amino acids in length. In one embodiment, the fragment is typically 5 to 37 contiguous amino acids in length. The fragment generally having a charge of between -9 and +3; typically a c-terminal amino acid that typically is not cysteine (C) or methionine (M); and typically an n-terminal amino acid that typcially is not cysteine (C), histidine (H), proline (P) or threonine (T). The charge of a peptide, fragment or region is determined using the method of Cameselle, J. C., Ribeiro, J. M., and Sillero, A. (1986). Derivation and use of a formula to calculate the net charge of acid-base compounds. Its application to amino acids, proteins and nucleotides. Biochem. Educ. 14, 131-136.

The term "natural" as applied to a peptide means a peptide that includes (a) a fragment of a plant protein, typically rice or pea protein, or variants of pea protein including lentil, sweet pea, or chick pea or variants of rice protein including oat, grass, corn, wild rice and bananas, or (b) a variant of the fragment of a plant protein, for example a fragment of a homolog of the plant protein. The peptides or fragments of the invention may be isolated from plant proteins or made synthetically.

"C-terminal domain" as applied to a fragment means the first three amino acids at the c-terminus of the fragment.

"N-terminal domain" as applied to a fragment means the last three amino acids at the n-terminus of the fragment.

"Bioactive" as applied to a peptide or fragment means having a health promoting effect when administered a mammal, for example one or more of glucose transport promoting, anti-bacterial, anti-inflammatory, or cellular growth or proliferation promoting. In one embodiment, the term "bioactive" means anti-inflammatory.

"Glucose transport promoting" or "glucose transport promoting activity" as applied to a peptide or variant or fragment means a peptide, variant or fragment that is capable of increasing GLUT4 translocation into skeletal muscle compared with an untreated control when employed at a concentration of 2 .mu.M in the following in-vitro assay. L6-GLUT4myc cells were grown in 10% FBS and 2 .mu.g/ml blasticidin. Cells were grown for 48-72 hours before being seeded in 24-well plates at 15,000 cells per well in 2% FBS and allowed to differentiate for 6 to 8 days prior to experimentation. L6-GLUT4myc cells were serum-starved for three hours prior to incubation with 100 nM of insulin for 30 mins, or 200, 20, 2.0 and 0.2 .mu.M of SP, and 2, 1, 0.5 and 0.25 mg/ml of peptide composition for 3 hours respectively. A 3 hour incubation period was selected based on previous findings identifying that incubation with branch chain amino acid containing di-peptides for 3 hours increases glucose uptake in L6 myotubes 1. Treatments were staggered in order to determine GLUT4myc translocation at the same time point. The quantity of myc-tagged GLUT4 at the cell surface was measured by antibody-coupled colorimetric assay. Briefly, after incubation with either insulin for 30 mins or synthetic peptide or peptide composition for 3 hours respectively, L6-GLUT4myc cells were fixed via incubation with 3% paraformaldehyde (PFA). A 0.1 M glycine solution was then added to quench PFA and cells were blocked with 5% goat serum. The myotube monolayer was exposed to anti-myc antibody and then incubated with peroxidase conjugated donkey anti-mouse IgG. 1 mL of o-phenylenediamine dihydrochloride (OPD) reagent was added to each well and this reaction was stopped by adding 250 .mu.l/well of 3 M HCL. To determine GLUT4 translocation to cell surface, a measured aliquot of each condition was determined spectrophotometrically on a plate reader using absorbance at 492 nm. Preferably the peptide or fragment is capable of increasing GLUT4 translocation compared with an untreated control by at least 50% (i.e a relative unit increase in GLUT4 translocation of 1% to 1.5%).

"Antibacterial" or "antibacterial activity" as applied to a peptide or fragment means a peptide or fragment that is capable of visibly inhibiting the growth of a bacteria in the following agar-plate based growth inhibition assay: Peptide stock=5 mg/mL dissolved in DMSO. Bacterial inoculums were adjusted to McFarland 0.5 standard and MHA plates swabbed. Blank disks were placed in the plates and 10 .mu.L of each compound (at 64 .mu.g/mL--maximum concentration tested) added. Plates were incubated at 37.degree. C. for 16-18 hours. Appropriate controls (DMSO; Mueller-Hinton media alone; and two antibiotic discs--ciprofloxacin and tetracycline) were also performed.

"Anti-inflammatory" as applied to a peptide or fragment means a peptide or fragment that is capable of significantly reducing the secretion of TNF.alpha. by LPS-stimulated J774.2 macrophages (compared with untreated LPS-stimulated J774.2 macrophages) when the macrophages are treated with 100 .mu.M of the peptide or fragment. J774.2 macrophages were treated with 100 .mu.M of synthetic peptide for 24 hours and then stimulated with (A) LPS (10 ng/ml) for five hours or (B) LPS (10 ng/ml) for 5 hours followed by ATP (5 mM) for one hour. Supernatant was collected and levels of TNF.alpha. were determined by ELISA.

"Cellular growth promoting" or "cellular growth or proliferation promoting" as applied to a peptide or fragment means a peptide or fragment that is capable of increasing elastin production or cellular proliferation of human skin treated with a 20 .mu.M solution of peptide or fragment in the following assay. Skin explants were prepared from abdominal plastic surgery.

Some explants were delipidated with alcohol to obtain a dehydrated skin. These explants were maintained in maintenance medium supplied by the provider Biopredic International for 5 days. Test items are applied twice per day with 5 .mu.L, per explant. At the end of the test, viabilities controls are realized with the MTT on two explants, the third explant is fixed in the formaldehyde 4% for histology and cell staining. For each time of analysis (D1 and D5), histologies on delipidated explants, treated explants with test items, the DMSO 0.3% control and water control, are performed. After receipt in the laboratory, each skin explant in the maintenance medium is delipidated with 5 .mu.L, alcohol during 3 hours. After 3 hours, all skin explants are treated two per day with test items, and they are incubated at 37.degree. C.+/-2.degree. C., 5% CO2 for 1 day or 5 days. Integrity of the system is realized at day 1 and day 5 with a viability control with MTT. Histology is realized by the laboratory Gredeco and the immunostaining to elastin and Ki67 are realized by the same laboratory. Immunostaining to filaggrin is realized by the laboratory Intertek. The detection of elastin (rabbit monoclonal antibody, clone P15502, LSBio) is performed using an immunoperoxidase technique two layers (ABC kit, Vector Laboratories) and revealed by AEC (3-amino-9-ethylcarbazole). The immunohistochemical staining intensity in the elastic fibers is evaluated using a semi-quantitative histological score. Epithelial proliferation was analyzed by immunohistochemistry using anti-Ki67 antibody. Immunodetection was performed using an indirect immunoperoxidase technique three layers, amplified (DAKO kit) and revealed by AEC (3-Amino-9-ethylcarbazole). Counting the number of labeled cells (keratinocytes of the basal layer of the epidermis) is performed and provides the total number of basal cells to calculate the % of labeled cells. The specific staining of filaggrin is performed with an immunoperoxidase staining (ABC kit, Fisher). The intensity of immunohistochemical marker in the epidermis is evaluated relative to the negative control of the solvent (Water or DMSO 0.3%).

"Enriched in peptides having a molecular weight of less than 10 KD" as applied to a composition of the invention means that the dry weight % of peptides in the composition having a molecular weight of less than 10 KD is greater than the dry weight % of polypeptide/protein in the composition having a molecular weight of 10 KD or greater.

"Homolog" of a reference protein should be understood to mean a protein from a different species of plant having at least 60% sequence homology with the reference protein. Thus, for example, homologs of pea protein P13918 include:

TABLE-US-00003 >gi|137584|sp|P08438.1|VCL_VICFA RecName: Full=Vicilin; Flags: Precursor [Vicia faba] >gi|22057|emb|CAA68559.1| vicilin [Vicia faba var. minor] >gi|383931031|gb|AFH56916.1| vicilin [Vicia faba] >gi|502105533|ref|XP_004492829.1| PREDICTED: vicilin-like isoform X1 [Cicer arietinum] ChickPea >gi|29539109|emb|CAD87730.1| allergen Len c 1.0101 [Lens culinaris] Lentil

A "variant" of an anti-inflammatory fragment shall be taken to mean a fragment having an amino acid sequence that is substantially identical to the anti-inflammatory fragment, and which has anti-inflammatory activity as defined above. Thus, for example, the term should be taken to include fragments that are altered in respect of one or more amino acid residues. Preferably such alterations involve the insertion, addition, deletion and/or substitution of 5 or fewer amino acids, more preferably of 4 or fewer, even more preferably of 3 or fewer, most preferably of 1 or 2 amino acids only. Insertion, addition and substitution with natural and modified amino acids is envisaged. The variant may have conservative amino acid changes, wherein the amino acid being introduced is similar structurally, chemically, or functionally to that being substituted. Generally, the variant will have at least 70% amino acid sequence homology, preferably at least 80% sequence homology, more preferably at least 90% sequence homology, and ideally at least 95%, 96%, 97%, 98% or 99% sequence homology with the parent anti-inflammatory fragment.

In this specification, the term "sequence identity" should be understand to comprise both sequence identity and similarity, i.e. a variant (or homolog) that shares 70% sequence identity with a reference sequence is one in which any 70% of aligned residues of the variant (or homolog) are identical to or conservative substitutions of the corresponding residues in the reference sequence across the entire length of the sequence. Sequence identity is the amount of characters which match exactly between two different sequences. Hereby, gaps are not counted and the measurement is relational to the shorter of the two sequences. In terms of "sequence homology", the term should be understood to mean that a variant (or homolog) which shares a defined percent similarity or identity with a reference sequence when the percentage of aligned residues of the variant (or homolog) are either identical to, or conservative substitutions of, the corresponding residues in the reference sequence and where the variant (or homolog) shares the same function as the reference sequence. This alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example, one alignment program is BLAST, using default parameters. Details of these programs can be found at the following Internet address: <www.ncbi.nlm.nih.gov/blast/Blast.cgi>

Variants of SEQ ID NO: 109 (anti-inflammatory peptide (I_37)

Variants of SEQ ID NO: 109 (RGPQQYAEWQINEK) including variants having 1, 2 or 3 conservative amino acid substitutions, 1, 2 to 3 non-conservative amino acid substitutions, 1-2 amino acid additions, 1, 2 or 3 amino acid deletions, are provided below:

One conservative amino acid substitution:

TABLE-US-00004 RGPQQYAEWQINER, (SEQ ID NO: 268); RGPQQYAEWQINDK, (SEQ ID NO: 269) RGPQQFAEWQINEK, (SEQ ID NO: 270); KGPQQYAEWQINEK, (SEQ ID NO: 271); RGPEQYAEWQINEK, (SEQ ID NO: 272); RGPQEYAEWQINEK, (SEQ ID NO: 273); RGPQQYADWQINEK, (SEQ ID NO: 274); RGPQQYAEYQINEK, (SEQ ID NO: 275).

Two conservative amino acid substitutions:

TABLE-US-00005 KGPEQYAEWQINEK, (SEQ ID NO: 276); KGPQEYAEWQINEK, (SEQ ID NO: 277); KGPQQFAEWQINEK, (SEQ ID NO: 278); RGPEQFAEWQINEK, (SEQ ID NO: 279); KGPQQYAEWQINER, (SEQ ID NO: 280); RGPQQYAEWQINDR, (SEQ ID NO: 281); RGPQQYADWQINDK, (SEQ ID NO: 282); RGPQQFAEWQINER, (SEQ ID NO: 283).

Three conservative amino acid substitutions:

TABLE-US-00006 RGPQQYAEWQVNEK, (SEQ ID NO: 284); RGPQQFAEWQINEK, (SEQ ID NO: 285); KGPQQFAEWQINER, (SEQ ID NO: 286); KGPQQFAEWQVNEK, (SEQ ID NO: 287); RGPQQFAEWQVNDK, (SEQ ID NO: 288); RGPQQYADWQINDR, (SEQ ID NO: 289); KGPQQYADWQINDK, (SEQ ID NO: 290); RGPQQFADYQINEK, (SEQ ID NO: 291).

One non-conservative amino acid substitution

TABLE-US-00007 RGPQQYARWQINEK, (SEQ ID NO: 292); RGPQQYAEWQINEE, (SEQ ID NO: 293); HGPQQYAEWQINEK, (SEQ ID NO: 294); RGPYQYAEWQINEK, (SEQ ID NO: 295); RGPQQYMEWQINEK, (SEQ ID NO: 296); RGPQQYAEWCINEK, (SEQ ID NO: 297); RGPQPYAEWQINEK, (SEQ ID NO: 292).

Two non-conservative amino acid substitution

TABLE-US-00008 RGGQQYAEWQINED, (SEQ ID NO: 299); RGPQQYARWKINEK, (SEQ ID NO: 300); RGGQQYAETQINEK, (SEQ ID NO: 301); RGPLQYAEWQNNEK, (SEQ ID NO: 302); EGPQQYAEWQINED, (SEQ ID NO: 303); RGPQQYAEWQINLL, (SEQ ID NO: 304); RGPQQGGEWQINEK, (SEQ ID NO: 305).

Three non-conservative amino acid substitution

TABLE-US-00009 RGPQQYAEWQIGGG, (SEQ ID NO: 306); RGPQQKYEWQINEK, (SEQ ID NO: 307); RGPQAQYEWQINEK, (SEQ ID NO: 308); RPHQQYAEWQINEK, (SEQ ID NO: 309); RGPQHHHEWQINEK, (SEQ ID NO: 310); RGPPQYAPPQINEK, (SEQ ID NO: 311); RGPQCYYEWCINEK, (SEQ ID NO: 312); RGPTQYAEGQINEG, (SEQ ID NO: 313).

One or two amino acid additions

TABLE-US-00010 RGPQQYAEWQINEKG, (SEQ ID NO: 314); RGPQQYAEWQINEKY, (SEQ ID NO: 315); RGPQQYAFTEWQINEK, (SEQ ID NO: 316); RGPQSQYAEWQINEKPM, (SEQ ID NO: 317); RGPQQYAEWQINEKKK, (SEQ ID NO: 318); RRRRGPQQYAEWQINEK (SEQ ID NO: 291).

The term "variant" typically encompasses fragments of the peptides of the invention. "Fragment of a peptide of the invention" or "peptide fragment" means a fragment of one of the peptides of the invention having at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 or 22 amino acids and that typically has a bioactivity, for example anti-inflammatory activity, cellular growth or proliferation promotion activity, glucose transport promoting activity, or anti-bacterial activity. In one embodiment, the fragment consists of at least 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the reference sequence. Examples of fragments of the invention are provided in SEQ ID NOS 320-330.

TABLE-US-00011 RGPQQYAEWQINE, (SEQ ID NO: 320); RGPQQYAEWQIN, (SEQ ID NO: 321); RGPQQYAEWQI, (SEQ ID NO: 322); GPQQYAEWQINEK, (SEQ ID NO: 323); PQQYAEWQINEK, (SEQ ID NO: 324); QQYAEWQINEK, (SEQ ID NO: 325); QQYAEWQI, (SEQ ID NO: 326); PQQYAEWQINE, (SEQ ID NO: 327); PQQYAEWQIN, (SEQ ID NO: 328); RGPQQYA, (SEQ ID NO: 329); EWQINEK (SEQ ID NO: 330.)

"Inflammatory disorder" means an immune-mediated inflammatory condition that affects humans and is generally characterised by dysregulated expression of one or more cytokines.

Examples of inflammatory disorders include skin inflammatory disorders, inflammatory disorders of the joints, inflammatory disorders of the cardiovascular system, certain autoimmune diseases, lung and airway inflammatory disorders, intestinal inflammatory disorders. Examples of skin inflammatory disorders include dermatitis, for example atopic dermatitis and contact dermatitis, acne vulgaris, and psoriasis. Examples of inflammatory disorders of the joints include rheumatoid arthritis. Examples of inflammatory disorders of the cardiovascular system are cardiovascular disease and atherosclerosis. Examples of autoimmune diseases include Type 1 diabetes, Graves disease, Guillain-Barre disease, Lupus, Psoriatic arthritis, and Ulcerative colitis. Examples of lung and airway inflammatory disorders include asthma, cystic fibrosis, COPD, emphysema, and acute respiratory distress syndrome. Examples of intestinal inflammatory disorders include colitis and inflammatory bowel disease. Other inflammatory disorders include cancer, hay fever, periodontitis, allergies, hypersensitivity, ischemia, depression, systemic diseases, post infection inflammation and bronchitis.

In this specification, the term "Metabolic disorder" should be understood to include pre-diabetes, diabetes; Type-1 diabetes; Type-2 diabetes; metabolic syndrome; obesity; diabetic dyslipidemia; hyperlipidemia; hypertension; hypertriglyceridemia; hyperfattyacidemia; hypercholerterolemia; hyperinsulinemia, and MODY.

"Man-made" as applied to comestible products should be understood to mean made by a human being and not existing in nature.

"Maintaining or restoring gut health": means reducing and/or regulating the pro-inflammatory response in the gut and more specifically the epithelial cells. The healthy microbiome offers some protection against pathogenic viruses and bacteria, and their presence is needed to guide the development of our immune system. It has been shown that these bacteria can react to human signals of stress, sickness, or age which can be manifested by inflammation and as a consequence switch on their virulence genes and cause or contribute to disease. Having the ability to reduce and maintain at healthy levels the inflammatory response can help maintain the healthy bacteria. Digestive problems, which comprise the number one health problem in North America, appear to be occurring with more frequency in recent years. One way to maintain digestive health is to maintain proper inflammation and intestinal flora.

"Maintaining or restoring muscle health" means helping retain or restore mammalian muscle health resulting from damage incurred during exercise. By lowering inflammation the peptides promote recovery from injuries during exercise, and relieve muscle soreness/pain and injury connected with exercise. They can also be used to decrease and prevent muscle cramping, and to allow a faster recovery from muscle cramping. Cramping can result from physical stress, mental stress, and or Repetitive Strain Injury stress. By lowering inflammation the peptides help reduce Myopathy of the muscle, and help prevent Sarcopenia in mammals, promote recovery from injuries during exercise, and relieve muscle soreness/pain and injury connected with exercise. They can also be used to decrease and prevent muscle cramping, and to allow a faster recovery from muscle cramping. Cramping can result from physical stress, mental stress, and or Repetitive Strain Injury stress. By lowering inflammation the peptides help reduce Myopathy of the muscle, and help prevent Sarcopenia in mammals.

In this specification, the term "composition" should be understood to mean something made by the hand of man, and not excludes naturally occurring compositions. Exemplary compositions include foods, beverages, nutritional supplements, personal care compositions, and pharmaceutical compositions.

In this specification, the term "substantially all" as applied to a list of peptides or fragments should be understood to mean at least 60%, 70%, 80%, 90% or 95% of the peptides or fragments.

In this specification, the term "personal care composition" should be understood to mean a composition formulated for use by humans in cleaning or treating the human body, particularly the skin, teeth, nails, feet and hair. Examples include shampoo, conditioner, skin creams and lotions, powders, dentrifice, shower gel or creams, body lotion, deodorant, and anti-perspirant.

In this specification, the term "nutritional supplement" should be understood to mean a product formulated for ingestion by a mammal and intended to confer a health benefit on the recipient. The supplement can take any form, for example a solid, liquid, or powder. Examples of supplements include powders, tablets, capsules, and drinks.

BRIEF DESCRIPTION OF THE FIGURES

FIGS. 1 to 18: The effect of eighteen synthetic peptides of the invention on TNF-secretion in THP1 cells. All experiments were prepared in duplicate on three plates (6 wells/conditions). Significance was calculated using Students t-test (*p<0.05 compared to control, **p<0.01 compared to control, *** p<0.001 compared to control). The figures correspond with the following SEQ ID Nos: FIG. 1 is SEQ ID NO: 339, FIG. 2 is SEQ ID NO: 352, FIG. 3 is SEQ ID NO: 341, FIG. 4 is SEQ ID NO: 351, FIG. 5 is SEQ ID NO: 144, FIG. 6 is SEQ ID NO: 93, FIG. 7 is SEQ ID NO: 320, FIG. 8 is SEQ ID NO: 92, FIG. 9 is SEQ ID NO: 75, FIG. 10 is SEQ ID NO: 76, FIG. 11 is SEQ ID NO: 349, FIG. 12 is SEQ ID NO: 350, FIG. 13 is SEQ ID NO: 105, FIG. 14 is SEQ ID NO: 177, FIG. 15 is SEQ ID NO: 345, FIG. 16 is SEQ ID NO: 353, FIG. 17 is SEQ ID NO: 344, FIG. 18 is SEQ ID NO: 346.

FIG. 19A-19B. Viability of J774.2 macrophages after treatment with synthetic peptides. J774.2 macrophages were treated 100 .mu.M of synthetic peptide for 24 hours before an alamar blue assay was performed. Data are presented as an average of n=3+/-SEM.

FIG. 20A-20B. The effects of peptide compositions on cell survival. J774.2 macrophages were treated with (FIG. 20A) 1 mg/ml or (FIG. 20B) 0.5 mg/ml of peptide compositions for 24 hours before an alamar blue assay was performed. Data is shown as (FIG. 20A) n=1+/-SEM and (FIG. 20B) n=3+/-SEM.

FIG. 21A-21B. The effect of DMSO vehicle on TNF.alpha. and IL-1.beta. secretion from J774.2 macrophages. J774.2 macrophages were treated with a final concentration of 0.3% and 1% DMSO (equivalent to the amounts used to dissolve the peptides) for 24 hours and the effect on TNF.alpha. (FIG. 21A) and IL-1.beta. (FIG. 21B) after stimulation was established. Data are presented as an average of n=3+/-SEM. (***p<0.001 w.r.t LPS).

FIG. 22A-22B. The effect of six peptides of the invention on TNF.alpha. and IL-1.beta. secretion from J774.2 macrophages. J774.2 macrophages were treated with 100 .mu.M of synthetic peptide for 24 hours and then stimulated with (FIG. 22A) LPS (10 ng/ml) for five hours or (FIG. 22B) LPS (10 ng/ml) for 5 hours followed by ATP (5 mM) for one hour. Supernatant was collected and levels of (FIG. 22A) TNF.alpha. and (FIG. 22B) IL-1.beta. were determined by ELISA. (***p<0.001 w.r.t LPS, **p<0.01 w.r.t LPS, *p<0.05, .sup.+++p<0.001 w.r.t. LPS/ATP, .sup.##p<0.01 w.r.t LPS/ATP and .sup.#p<0.05 w.r.t LPS/ATP). Final concentration of DMSO in well: SP1--0.3%, SP2--0%, SP3--0.3%, SP4--1%, SP5--1%, SP6--0.3%, Positive Control--0%. Data are presented as an average of n=3+/-SEM.

FIG. 23A-23B. The effect a peptide composition of the invention on TNF.alpha. and IL-1.beta. secretion. J774.2 macrophages were treated with 0.5 mg/ml of peptide composition for 24 hours and then stimulated with (FIG. 23A) LPS (10 ng/ml) for five hours or (FIG. 23B) LPS (10 ng/ml) for 5 hours followed by ATP (5 mM) for one hour. Supernatant was collected and levels of (FIG. 23A) TNF.alpha. and (FIG. 23B) IL-1.beta. were determined by ELISA. (***p<0.001 w.r.t untreated+LPS, ###p<0.001 w.r.t. untreated+LPS/ATP). Data are presented as an average of n=3+/-SEM.

FIG. 24. The effects of synthetic peptides with DMSO vehicle on TNF.alpha. J774.2 macrophages were treated with 100 .mu.M of synthetic peptide for 24 hours and then LPS (10 ng/ml) for five hours. Supernatant was collected and levels of TNF.alpha. were determined by ELISA. ###p<0.001 w.r.t 0.3% DMSO+LPS, ##p<0.01 w.r.t. 0.3% DMSO+LPS, +++p<0.001 w.r.t 1% DMSO+LPS, ++p<0.01 w.r.t 1% DMSO+LPS/ATP). Final concentration of DMSO in well: positive control--0%, SP1--0.3%, SP2--0%, SP3--0.3%, SP4--1%, SP5--1%, SP6--0.3%.

FIG. 25. THP-1 differentiated macrophages treated with a composition of rice peptides of the invention (I_2_HR) for 24 hrs. prior to LPS stimulation were compared to untreated cells. TNF-.alpha. secretion in I_2_HR treated cells is reduced by 92% vs. untreated cells. Significant results are observed at 100 ug/ml and 500 ug/ml concentrations of I_2_HR, indicating the potency of I_2_HR.

FIGS. 26 to 28. The effect of three synthetic peptides of the invention on TNF-secretion in THP1 cells. All experiments were prepared in duplicate on three plates (6 wells/conditions). Significance was calculated using Students t-test (*p<0.05 compared to control, **p<0.01 compared to control, *** p<0.001 compared to control). The figures correspond with the following SEQ ID Nos: FIG. 26 is SEQ ID NO: 85, FIG. 27 is SEQ ID NO: 91, FIG. 28 is SEQ ID NO: 420.

DETAILED DESCRIPTION OF THE INVENTION

Example 1--Inflammatory Response

TNF-.alpha. is secreted by macrophages in response to stimulation by endotoxins such as lipopolysaccharides (LPS). TNF-.alpha. is thought to be involved in systemic inflammation and dysregulation of TNF-.alpha. production is thought to be involved in many diseases. The Biolegend assay is a sandwich ELISA kit that is designed for the accurate quantitation of human TNF-.alpha. from cell culture supernatant, serum or plasma.

THP-1 monocytes were seeded in a 96 well plate at 10,000 cells per well in RPMI containing 10% fetal calf serum (FCS), 1% Pen/strep, 1% L-glutamine, 100 nM PMA and allowed to differentiated for 72 h prior to experimentation.

Following differentiation the cells were incubated with 100 ng/ml, 10 ng/ml or 1 ng/ml synthetic peptide for 24 h respectively.

Following treatment the cells were stimulated with 10 ng/ml LPS for 5 h and the quantity of TNF-.alpha. in the supernatant determined using the Biolegend assay ELISA kit.

Results were calculated as a percentage of the untreated control. An increase in optical density reading indicates greater quantity of TNF-.alpha. release into cell culture supernatant.

The results are provided in FIGS. 1 to 21 and summarised in Table 1 below. All experiments were prepared in duplicate on three plates (6 wells/conditions). Significance was calculated using Students t-test (*p<0.05 compared to control, **p<0.01 compared to control, *** p<0.001 compared to control).

TABLE-US-00012 TABLE 1 FIG. NUMBER SEQ ID TNF-.alpha. DECREASE FIG. 1 339 26% FIG. 2 352 23% FIG. 3 341 21% FIG. 4 351 18% FIG. 5 144 16% FIG. 6 93 14% FIG. 7 320 13% FIG. 8 92 13% FIG. 9 75 11% FIG. 10 76 9% FIG. 11 349 6% FIG. 12 350 FIG. 13 105 9% FIG. 14 177 FIG. 15 345 23% FIG. 16 353 20% FIG. 17 344 20% FIG. 18 346 18% FIG. 26 85 80% FIG. 27 91 80% FIG. 28 420 80%

Example 2--Inflammatory Response

The effect of six synthetic peptides of the invention, SP1 to SP6 (SEQ ID NO: 108, 109, 110, 111, 85 and 91) and four peptide compositions on the inflammatory response in vitro using a cell line was determined.

Peptide composition I_1_HR (Rice) contained the followings peptides (identified by SEQ ID): 116, 197, 207, 112, 211, 158, 201, 203, 114, 183, 130, 113, 182, 167, 166, 152, 220, 213, 215, 154, 219, 218, 165, 123, 185, 190, 209, 181, 198, 200, 147, 172, 184, 124, 153, 205, 115, 196, 151, 161, 160, 216, 210, 208, 146, 133, 204, 212, 206.

Peptide composition I_2_HR (Rice) contained the followings peptides (identified by SEQ ID): 189, 177, 174, 129, 176, 202, 193, 195, 194, 192, 182, 128, 220, 127, 134, 136, 135, 180, 179, 178, 219, 218, 145, 120, 175, 190, 149, 126, 187, 191, 121, 122, 159, 132, 162, 137, 150, 186, 188, 164, 118, 125, 163, 157, 156, 117.

Peptide composition E_1_HR (Pea) contained the followings peptides (identified by SEQ ID):74, 76, 106, 102, 101, 100, 92, 96, 83, 89, 90, 104, 82, 75, 79, 78, 77, 99, 103, 72, 86, 105, 94, 93, 81, 97, 80, 88, 85, 87, 71, 107, 73, 84, 98, 95.

Peptide composition E_2_HR contained homologs of the peptides of the invention.

A J774.2 mouse macrophage cell line was treated with 100 .mu.M of each synthetic peptide (SP) and 0.5 mg/ml of each peptide composition and the effect on two pro-inflammatory markers--tumour necrosis factor .alpha. (TNF.alpha.) and interleukin-1.beta. (IL-1.beta.) was determined after inflammation was induced using lipopolysaccharide (LPS) as an inflammatory stimulus. A one way anova was used with the dunnett test which is a multiple comparison and compares every mean with a single control mean.

Example 3--Synthetic Peptides: Cell Viability

Synthetic peptides were first diluted in a suitable solvent. Dimethyl sulfoxide (DMSO) was the solvent of choice for peptides with poor predicted water solubility. Final concentration of DMSO in each well: SP1 (1_155 HR)--0.3%, SP2 (1_374 HR)--0%, SP3 (E_155 HR)--0.3%, SP4 (E_54_HR)--1%, SP5 (E_41_HR)--1%, SP6 (E 788 HR)--0.3%, positive Control--0%. Cells were first treated with 100 .mu.M of each SP for 24 hours before an alamar blue assay was performed. No viability issues were seen with any of the peptides.

Example 4--Peptide Compositions: Preparation and Toxicity

The peptide compositions were prepared by adjusting the pH to between 6-7 and sterile filtering. The effects of the peptide compositions on cell viability was determined. J774.2 macrophages were treated with 1 mg/ml and 0.5 mg/ml of each peptide composition, hydrogen peroxide to induce cell death as a positive control, and a peptide known to be non-toxic as a negative control. An alamar blue assay was then performed and cell survival is shown in FIG. 19 as a percentage of untreated (100%). As cell survival was compromised with 1 mg/ml of peptide, 0.5 mg/ml of peptide composition was used for further assays.

Example 5--Inflammatory Markers

The effect of the DMSO on TNF.alpha. and IL-1.beta. secretion was determined. 1% DMSO significantly increased levels of TNF.alpha. (FIG. 3A. ***p<0.001 w.r.t LPS) and this was taken into account when analysing the effect of the peptides on TNF.alpha.. No significant effect was seen with regards DMSO and IL-1.beta. secretion.

Example 6--Inflammatory Response

THP-1 differentiated macrophages were treated with a composition of rice peptides of the invention (I_2_HR) for 24 hrs. prior to LPS stimulation were compared to untreated cells. TNF-.alpha. secretion in I_2_HR treated cells is reduced by 92% vs. untreated cells. Significant results are observed at 100 ug/ml and 500 ug/ml concentrations of I_2_HR, indicating the potency of I_2_HR.

The invention is not limited to the embodiments hereinbefore described which may be varied in construction and detail without departing from the spirit of the invention.

TABLE-US-00013 SEQUENCE INFORMATION PEA PROTEIN 1: P13918 - 1 - MAATTMKASFPLLMLMGISFLASVCVSSRSDPQNPFIFKSNKFQTLFENENGHIRLLQKFDQRSKIFENLQNYR- LLEYKSKPHTIFLPQHTDA DYILVVLSGKAILTVLKPDDRNSFNLERGDTIKLPAGTIAYLVNRDDNEELRVLDLAIPVNRPGQLQSFLLSGN- QNQQNYLSGFSKNILEASFN TDYEEIEKVLLEEHEKETQHRRSLKDKRQQSQEENVIVKLSRGQIEELSKNAKSTSKKSVSSESEPFNLRSRGP- IYSNEFGKFFEITPEKNPQLQ DLDIFVNSVEIKEGSLLLPHYNSRAIVIVTVNEGKGDFELVGQRNENQQEQRKEDDEEEEQGEEEINKQVQNYK- AKLSSGDVFVIPAGHPVA VKASSNLDLLGFGINAENNQRNFLAGDEDNVISQIQRPVKELAFPGSAQEVDRILENQKQSHFADAQPQQRERG- SRETRDRLSSV [SEQ ID 1] REGION: 253 to 274 - PFNLRSRGPIYSNEFGKFFEIT [SEQ ID 17] PEPTIDE: SRGPIYSNEFGK [SEQ ID 71] REGION: 110 to 126 - KPDDRNSFNLERGDTIK [SEQ ID 18] PEPTIDE: NSFNLER [SEQ ID 72] REGION: 134 to 160 - YLVNRDDNEELRVLDLAIPVNRPGQLQ [SEQ ID 19] PEPTIDE: VLDLAIPVNR [SEQ ID 73] PEPTIDE: DDNEELR [SEQ ID 74] REGION: 331 to 381 - QEQRKEDDEEEEQGEEEINKQVQNYKAKLSSGDVFVIPAGHPVAVKASSNL [SEQ ID 20] PEPTIDE: LSSGDVFVIPAGHPVAVK [SEQ ID 75] PEPTIDE: EDDEEEEQGEEEINK [SEQ ID 76] REGION: 175 to 242 - SGFSKNILEASFNTDYEEIEKVLLEEHEKETQHRRSLKDKRQQSQEENVIVKLSRGQIEELSKNAKST [SEQ ID 21] PEPTIDE: NILEASFNTDYEEIEKVLLEEHEKETQHR [SEQ ID 77] PEPTIDE: NILEASFNTDYEEIEKVLLEEHEK [SEQ ID 78] PEPTIDE: NILEASFNTDYEEIEK [SEQ ID 79] PEPTIDE: RQQSQEENVIVK [SEQ ID 80] PEPTIDE: QQSQEENVIVK [SEQ ID 81] PEPTIDE: LSRGQIEELSK [SEQ ID 82] PEPTIDE: GQIEELSK [SEQ ID 83] PEPTIDE: VLLEEHEK [SEQ ID 84] REGION: 35 to 108 - PFIFKSNKFQTLFENENGHIRLLQKFDQRSKIFENLQNYRLLEYKSKPHTIFLPQHTDADYILVVLSGKAILT- V [SEQ ID 22] PEPTIDE: SKPHTIFLPQHTDADYILVVLSGK [SEQ ID 85] PEPTIDE: PHTIFLPQHTDADYILVVLSGK [SEQ ID 86] PEPTIDE: SNKFQTLFENENGHIR [SEQ ID 87] PEPTIDE: SKIFENLQNYR [SEQ ID 88] PEPTIDE: IFENLQNYR [SEQ ID 89] REGION: 423 to 450 - QEVDRILENQKQSHFADAQPQQRERGSR [SEQ ID 23] PEPTIDE: ILENQKQSHFADAQPQQR [SEQ ID 90] PEPTIDE PGQLQSFLLSGNQNQQNYLSGFSK [SEQ ID 91] PEA PROTEIN 2: P02856 - 2 - DRRQELSNENVLVKVSRRQLEELSKNAKSSSRRSVSSESGPFNLRSEDPLYSNNSGKFFELTPEKNQQLQDLDL- FVNSVDLKEGSLLLPNYNS RALLVLVLVVNEGKGDFELVGQRNENQGKEN [SEQ ID 2] REGION: 53 to 87 - NNSGKFFELTPEKNQQLQDLDLFVNSVDLKEGSLL [SEQ ID 24] PEPTIDE: FFELTPEKNQQLQDLDLFVNSVDLK [SEQ ID 92] REGION: 14 to 30 - KVSRRQLEELSKNAKSS [SEQ ID 25] PEPTIDE: QLEELSK [SEQ ID 93] PEA PROTEIN 3: P15838 - 3 - MATKLLALSLSFCFLLLGGCFALREQPEQNECQLERLNALEPDNRIESEGGLIETWNPNNKQFRCAGVALSRAT- LQHNALRRPYYSNAPQEI FIQQGNGYFGMVFPGCPETFEEPQESEQGEGRRYRDRHQKVNRFREGDIIAVPTGIVFWMYNDQDTPVIAVSLT- DIRSSNNQLDQMPRR FYLAGNHEQEFLRYQHQQGGKQEQENEGNNIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLS- IISPPEKQARHQRGSR QEEDEDEDEERQPRHQRGSRQEEEEDEDEERQPRHQRRRGEEEEEDKKERRGSQKGKSRRQGDNGLEETVCTAK- LRLNIGPSSSPDIYNPE AGRIKTVTSLDLPVLRWLKLSAEHGSLHKNAMFVPHYNLNANSIIYALKGRARLQVVNCNGNTVFDGELEAGRA- LTVPQNYAVAAKSLSD RFSYVAFKTNDRAGIARLAGTSSVINNLPLDVVAATFNLQRNEARQLKSNNPFKFLVPARQSENRASA [SEQ ID 3] REGION: 267 to 287- QRGSRQEEDEDEDEERQPRHQ [SEQ ID 26] PEPTIDE: QEEDEDEDEER [SEQ ID 94] REGION: 190 to 222- QEFLRYQHQQGGKQEQENEGNNIFSGFKRDFLE [SEQ ID 27] PEPTIDE: YQHQQGGKQEQENEGNNIFSGFK [SEQ ID 95] PEA PROTEIN 4: Q9M3X6 - 4 - MATTIKSRFPLLLLLGIIFLASVVCVTYANYDEGSEPRVPAQRERGRQEGEKEEKRHGEWRPSYEKEEDEEEGQ- RERGRQEGEKEEKRHGE WRPSYEKQEDEEEKQKYRYQREKEDEEEKQKYQYQREKKEQKEVQPGRERWEREEDEEQVDEEWRGSQRREDPE- ERARLRHREERTKR DRRHQREGEEEERSSESQERRNPFLFKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIF- LPQHIDADLILVVLSGKAILT VLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRLVDLVIPVNGPGKFEAFDLAKNKNQYLRGFSKNILE- ASYNTRYETIEKVLLEEQE KDRKRRQQGEETDAIVKVSREQIEELKKLAKSSSKKSLPSEFEPINLIRSHKPEYSNKFGKLFEITPEKKYPQL- QDLDLFVSCVEINEGALMLPHY NSRAIVVLLVNEGKGNLELLGLKNEQQEREDRKERNNEVQRYEARLSPGDVVIIPAGHPVAITASSNLNLLGFG- INAENNERNFLSGSDDNV ISQIENPVKELTFPGSVQEINRLIKNQKQSHFANAEPEQKEQGSQGKRSPLSSILGTFY [SEQ ID 4] REGION: 284 to 317 - YNLERGDTIKLPAGTTSYLVNQDDEEDLRLVDLV [SEQ ID 28] PEPTIDE: GDTIKLPAGTTSYLVNQDDEEDLR [SEQ ID 96] REGION: 321 to 400 - NGPGKFEAFDLAKNKNQYLRGFSKNILEASYNTRYETIEKVLLEEQEKDRKRRQQGEETDAIVKVSREQIEELK- KLAKSS [SEQ ID 29] PEPTIDE: RQQGEETDAIVK [SEQ ID 97] PEPTIDE: VLLEEQEKDRK [SEQ ID 98] PEPTIDE: NILEASYNTR [SEQ ID 99] PEPTIDE: FEAFDLAK [SEQ ID 100] PEPTIDE: EQIEELKK [SEQ ID 101] PEPTIDE: EQIEELK [SEQ ID 102] PEPTIDE: NKNQYLR [SEQ ID 103] REGION: 503 to 549 - RYEARLSPGDVVIIPAGHPVAITASSNLNLLGFGINAENNERNFLSG [SEQ ID 30] PEPTIDE: LSPGDVVIIPAGHPVAITASSNLNLLGFGINAENNER [SEQ ID 104] REGION: 89 to 112 - HGEWRPSYEKQEDEEEKQKYRYQR [SEQ ID 31] PEPTIDE: PSYEKQEDEEEKQK [SEQ ID 105] REGION: 62 to 80 - PSYEKEEDEEEGQRERGRQ [SEQ ID 32] PEPTIDE: EEDEEEGQR [SEQ ID 106] PEA PROTEIN 5: D3VNE1 - 5 - MAATPIKPLMLLAIAFLASVCVSSRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEY- KSKPRTLFLPQYTDADFILVV LSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLTIPVNKPGQLQSFLLSGTQNQPSL- LSGFSKNILEAAFNTNYEEI EKVLLEQQEQEPQHRRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF- GKFFEITPEKNQQLQDLDIF VNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVF- VIPAGHPVAINASSDLNLI GFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE [SEQ ID 5] REGION: 75 to 104 - KSKPRTLFLPQYTDADFILVVLSGKATLTV [SEQ ID 33] PEPTIDE: TLFLPQYTDADFILVVLSGK [SEQ ID 107] RICE PROTEIN 7: Q6K508 MATTTSLLSSCLCALLLAPLFSQGVDAWESRQGASRQCRFDRLQAFEPLRKVRSEAGDTE YFDERNEQFRCAGVFVIRRVIEPQGLVVPRYSNTPALAYIIQGKGYVGLTFPGCPATHQQ QFQLFEQRQSDQAHKFRDEHQKIHEFRQGDVVALPASVAHWFYNGGDTPAVVVYVYDIKS FANQLEPRQKEFLLAGNNQRGQQIFEHSIFQHSGQNIFSGFNTEVLSEALGINTEASKRL QSQNDQRGDIIRVKHGLQLLKPTLTQRQEEHRQYQQVQYREGQYNGLDENFCTIKARVNI ENPSRADYYNPRAGRITLLNNQKFPILNLIGMGAARVNLYQNALLSPFWNINAHSVVYII QGSVRVQVANNQGRSVFNGVLHQGQLLIIPQNHAVIKKAEHNGCQYVAIKTISDPTVSWV AGKNSILRALPVDVIANAYRISRDEARRLKNNRADEIGPFTPRFPQKSQRGYQFLTEGLS LIGM [SEQ ID 6] PEPTIDE: GYVGLTFPGCPATHQQQFQLFEQR [SEQ ID 108] RICE PROTEIN 8: Q6K7K6 MASMSTILPLCLGLLLFFQVSMAQFSFGGSPLQSPRGFRGDQDSRHQCRFEHLTALEATH QQRSEAGFTEYYNIEARNEFRCAGVSVRRLVVESKGLVLPMYANAHKLVYIVQGRGVFGM ALPGCPETFQSVRSPFEQEVATAGEAQSSIQKMRDEHQQLHQFHQGDVIAVPAGVAHWLY NNGDSPVVAFTVIDTSNNANQLDPKRREFFLAGKPRSSWQQQSYSYQTEQLSRNQNIFAG FSPDLLSEALSVSKQTVLRLQGLSDPRGAIIRVENGLQALQPSLQVEPVKEEQTQAYLPT KQLQPTWLRSGGACGQQNVLDEIMCAFKLRKNIDNPQSSDIFNPHGGRITRANSQNFPIL NIIQMSATRIVLQNNALLTPHWTVNAHTVMYVTAGQGHIQVVDHRGRSVFDGELHQQQIL LIPQNFAVVVKARREGFAWVSFKTNHNAVDSQIAGKASILRALPVDVVANAYRLSREDSR HVKFNRGDEMAVFAPRRGPQQYAEWQINEK [SEQ ID 7] PEPTIDE: RGPQQYAEWQINEK [SEQ ID 109] PEA PROTEIN 6: P13919 MATTIKSRFPLLLLLGIIFLASVVSVTYANYDEGSEPRVPAQRERGRQEGEKEEKRHGEW RPSYEKEEDEEEGQRERGRQEGEKEEKRHGEWGPSYEKQEDEEEKQKYRYQREKEDEEEK QKYQYQREKKEQKEVQPGRERWEREEDEEQVDEEWRGSQRREDPEERARLRHREERTKRD RRHQREGEEEERSSESQERRNPFLFKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNY RLVEYRAKPHTIFLPQHIDADLILVVLSGKAILTVLSPNDRNSYNLERGDTIKLPAGTTS YLVNQDDEEDLRLVDLVIPVNGPGKFEAFDLAKNKNQYLRGFSKNILEASYNTRYETIEK VLLEEQEKDRKRRQQGEETDAIVKVS [SEQ ID 8] PEPTIDE: LVDLVIPVNGPGKFEAFDLAK [SEQ ID 110] PEA PROTEIN 7: P02855 MATTIKSRFPLLLLLGIIFLASVVSVTYANYDEGSEPRVPAQRERGRQEGEKEEKRHGEW RPSYEKEEDEEEGQRERGRQEGEKEEKRHGEWGPSYEKQEDEEEKQKYRYQREKEDEEEK QKYQYQREKKEQKEVQPGRERWEREEDEEQVDEEWRGSQRREDPEERARLRHREERTKRD RRHQREGEEEERSSESQERRNPFLFKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNY RLVEYRAKPHTIFLPQHIDADLILVVLSGKAILTVLSPNDRNSYNLERGDTIKLPAGTTS YLVNQDDEEDLRLVDLVIPVNGPGKFEAFDLAKNKNQYLRGFSKNILEASYNTRYETIEK VLLEEQEKDRKRRQQGEETDAIVKVS [SEQ ID 9] PEPTIDE: KNPQLQDLDIFVNYVEIK [SEQ ID 111] RICE PROTEIN 1: P14323 - 1 - MASSVFSRFSIYFCVLLLCHGSMAQLFNPSTNPWHSPRQGSFRECRFDRLQAFEPLRKVRSEAGVTEYFDEKNE- LFQCTGTFVIRRVIQPQG LLVPRYTNIPGVVYIIQGRGSMGLTFPGCPATYQQQFQQFSSQGQSQSQKFRDEHQKIHQFRQGDIVALPAGVA- HWFYNDGDAPIVAVY VYDVNNNANQLEPRQKEFLLAGNNNRAQQQQVYGSSIEQHSGQNIFSGFGVEMLSEALGINAVAAKRLQSQNDQ- RGEIIHVKNGLQLLK PTLTQQQEQAQAQDQYQQVQYSERQQTSSRWNGLEENFCTIKVRVNIENPSRADSYNPRAGRITSVNSQKFPIL- NLIQMSATRVNLYQN AILSPFWNVNAHSLVYMIQGRSRVQVVSNFGKTVFDGVLRPGQLLIIPQHYAVLKKAEREGCQYIAIKTNANAF- VSHLAGKNSVFRALPVD VVANAYRISREQARSLKNNRGEEHGAFTPRFQQQYYPGLSNESESETSE [SEQ ID 10] REGION: 138 to 159 - SQSQKFRDEHQKIHQFRQGDIV [SEQ ID 34] PEPTIDE: DEHQKIHQFR [SEQ ID 112] PEPTIDE: FRDEHQK [SEQ ID 113] REGION: 336 to 358 - VNSQKFPILNLIQMSATRVNLYQ [SEQ ID 35] PEPTIDE: FPILNLIQMSATR [SEQ ID 114] REGION: 423 to 462 - YIAIKTNANAFVSHLAGKNSVFRALPVDVVANAYRISREQ [SEQ ID 36] PEPTIDE: TNANAFVSHLAGK [SEQ ID 115] PEPTIDE: ALPVDVVANAYR [SEQ ID 116] REGION: 175 to 205 - APIVAVYVYDVNNNANQLEPRQKEFLLAGNN [SEQ ID 37] PEPTIDE: YVYDVNNNANQLEPRQKEFL [SEQ ID 117] PEPTIDE: VYVYDVNNNANQLEPRQKEFL [SEQ ID 118] REGION: 318 to 334 - ENPSRADSYNPRAGRIT [SEQ ID 38] PEPTIDE: ADSYNPR [SEQ ID 119] REGION: 265 to 296 - GLQLLKPTLTQQQEQAQAQDQYQQVQYSERQQ [SEQ ID 39] PEPTIDE: KPTLTQQQEQAQAQDQ [SEQ ID 120] PEPTIDE: QAQAQDQYQQVQY [SEQ ID 121] PEPTIDE: QAQDQYQQVQY [SEQ ID 122] REGION: 45 to 62 - CRFDRLQAFEPLRKVRSE [SEQ ID 40] PEPTIDE: LQAFEPLR [SEQ ID 123] REGION: 361 to 408 - ILSPFWNVNAHSLVYMIQGRSRVQVVSNFGKTVFDGVLRPGQLLIIPQ [SEQ ID 41] PEPTIDE: SRVQVVSNFGK [SEQ ID 124] PEPTIDE: WNVNAHSLVY [SEQ ID 125] PEPTIDE: NVNAHSLVY [SEQ ID 126] PEPTIDE: IQGRSRVQVVSNFGK [SEQ ID 127] PEPTIDE: GKTVFDGVLRPGQL [SEQ ID 128] PEPTIDE: FGKTVFDGVLRPGQL [SEQ ID 129] REGION: 476 to 499 - AFTPRFQQQYYPGLSNESESETSE [SEQ ID 42] PEPTIDE: FQQQYYPGLSNESESETSE [SEQ ID 130] PEPTIDE: QQYYPGLSN [SEQ ID 131] PEPTIDE: QQQYYPGLSN [SEQ ID 132] RICE PROTEIN 2: P07728 - 2 - MASINRPIVFFTVCLFLLCNGSLAQQLLGQSTSQWQSSRRGSPRECRFDRLQAFEPIRSVRSQAGTTEFFDVSN- EQFQCTGVSVVRRVIEPR GLLLPHYTNGASLVYIIQGRGITGPTFPGCPESYQQQFQQSGQAQLTESQSQSQKFKDEHQKIHRFRQGDVIAL- PAGVAHWCYNDGEVPV VAIYVTDLNNGANQLDPRQRDFLLAGNKRNPQAYRREVEERSQNIFSGFSTELLSEALGVSSQVARQLQCQNDQ-

RGEIVRVEHGLSLLQPY ASLQEQEQGQVQSRERYQEGQYQQSQYGSGCSNGLDETFCTLRVRQNIDNPNRADTYNPRAGRVTNLNTQNFPI- LSLVQMSAVKVNLY QNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGELRRGQLLIIPQHYAVVKKAQREGCAYIAFKTNPN- SMVSHIAGKSSIFRAL PNDVLANAYRISREEAQRLKHNRGDEFGAFTPIQYKSYQDVYNAAESS [SEQ ID 11] REGION: 332 to 362 - PRAGRVTNLNTQNFPILSLVQMSAVKVNLYQ [SEQ ID 43] PEPTIDE: VTNLNTQNFPILSLVQMSAVK [SEQ ID 133] REGION: 375 to 406 - HSVVYITQGRARVQVVNNNGKTVFNGELRRGQ [SEQ ID 44] PEPTIDE: ITQGRARVQVVNNNGKTVF [SEQ ID 134] PEPTIDE: ITQGRARVQVVNNNGKTVFNGE [SEQ ID 135] PEPTIDE: ITQGRARVQVVNNNGKTVFNG [SEQ ID 136] PEPTIDE: RVQVVNNNGKTVF [SEQ ID 137] REGION: 440 to 471 - HIAGKSSIFRALPNDVLANAYRISREEAQRLK [SEQ ID 45] PEPTIDE: RALPNDVLANAYRISREE [SEQ ID 138] PEPTIDE: SIFRALPNDVLANAYR [SEQ ID 139] PEPTIDE: SIFRALPNDVLANAY [SEQ ID 140] PEPTIDE: SIFRALPNDVLAN [SEQ ID 141] PEPTIDE: SSIFRALPNDVLANAYR [SEQ ID 142] PEPTIDE: SIFRALPNDVLANAYRISREE [SEQ ID 143] PEPTIDE: SIFRALPND [SEQ ID 144] REGION: 180 to 208 - VPVVAIYVTDLNNGANQLDPRQRDFLLAG [SEQ ID 46] PEPTIDE: IYVTDLNNGANQLDPRQRD [SEQ ID 145] RICE PROTEIN 3: P07730 - 2 - MASINRPIVFFTVCLFLLCDGSLAQQLLGQSTSQWQSSRRGSPRGCRFDRLQAFEPIRSVRSQAGTTEFFDVSN- ELFQCTGVSVVRRVIEPR GLLLPHYTNGASLVYIIQGRGITGPTFPGCPETYQQQFQQSGQAQLTESQSQSHKFKDEHQKIHRFRQGDVIAL- PAGVAHWCYNDGEVPV VAIYVTDINNGANQLDPRQRDFLLAGNKRNPQAYRREVEEWSQNIFSGFSTELLSEAFGISNQVARQLQCQNDQ- RGEIVRVERGLSLLQPY ASLQEQEQGQMQSREHYQEGGYQQSQYGSGCPNGLDETFCTMRVRQNIDNPNRADTYNPRAGRVTNLNSQNFPI- LNLVQMSAVKVN LYQNALLSPFWNINAHSIVYITQGRAQVQVVNNNGKTVFNGELRRGQLLIVPQHYVVVKKAQREGCAYIAFKTN- PNSMVSHIAGKSSIFR ALPTDVLANAYRISREEAQRLKHNRGDEFGAFTPLQYKSYQDVYNVAESS [SEQ ID 12] REGION: 311 to 362 - TFCTMRVRQNIDNPNRADTYNPRAGRVTNLNSQNFPILNLVQMSAVKVNLYQ [SEQ ID 47] PEPTIDE: VTNLNSQNFPILNLVQMSAVK [SEQ ID 146] PEPTIDE: QNIDNPNR [SEQ ID 147] PEPTIDE: ADTYNPR [SEQ ID 148] PEPTIDE: NIDNPNRADTYNPRAGRVTNL [SEQ ID 149] PEPTIDE: RVRQNIDNPNRADTYNPRAGRVTNL [SEQ ID 150] REGION: 427 to 499 - YIAFKTNPNSMVSHIAGKSSIFRALPTDVLANAYRISREEAQRLKHNRGDEFGAFTPLQYKSYQDVYNVAESS[- SEQ ID 48] PEPTIDE: TNPNSMVSHIAGKSSIFR [SEQ ID 151] PEPTIDE: HNRGDEFGAFTPLQYK [SEQ ID 152] PEPTIDE: SYQDVYNVAESS [SEQ ID 153] PEPTIDE: ISREEAQR [SEQ ID 154] PEPTIDE: SIFRALPTDVLANAYRISREE [SEQ ID 155] PEPTIDE: YRISREEAQRLKHNRGDEF [SEQ ID 156] PEPTIDE: YRISREEAQRLKHNRGDE [SEQ ID 157] REGION: 143 to 178 - SQSHKFKDEHQKIHRFRQGDVIALPAGVAHWCYNDG [SEQ ID 49] PEPTIDE: FKDEHQKIHR [SEQ ID 158] PEPTIDE: QGDVIALPAGVAHW [SEQ ID 159] REGION: 381 to 409 - TQGRAQVQVVNNNGKTVFNGELRRGQLLI [SEQ ID 50] PEPTIDE: TVFNGELRR [SEQ ID 160] PEPTIDE: TVFNGELR [SEQ ID 161] PEPTIDE: QVQVVNNNGKTVF [SEQ ID 162] REGION: 101 to 124 - NGASLVYIIQGRGITGPTFPGCPE [SEQ ID 51] PEPTIDE: YIIQGRGITGPTF [SEQ ID 163] PEPTIDE: VYIIQGRGITGPTF [SEQ ID 164] REGION: 46 to 66 - CRFDRLQAFEPIRSVRSQAGT [SEQ ID 52] PEPTIDE: LQAFEPIRSVR [SEQ ID 165] REGION: 253 to 292 - QNDQRGEIVRVERGLSLLQPYASLQEQEQGQMQSREHYQE [SEQ ID 53] PEPTIDE: GLSLLQPYASLQEQEQGQMQSR [SEQ ID 166] PEPTIDE: GEIVRVER [SEQ ID 167] PEPTIDE: RGLSLLQPYASLQ [SEQ ID 168] PEPTIDE: RGLSLLQPYASLQEQ [SEQ ID 169] PEPTIDE: RGLSLLQPYASLQEQE [SEQ ID 170] PEPTIDE: RGLSLLQPYASLQE [SEQ ID 171] REGION: 199 to 233 - PRQRDFLLAGNKRNPQAYRREVEEWSQNIFSGFST [SEQ ID 54] PEPTIDE: RNPQAYR [SEQ ID 172] PEPTIDE: FLLAGNKRNPQAY [SEQ ID 173] PEPTIDE: EVEEWSQNIF [SEQ ID 174] PEPTIDE: LAGNKRNPQAYR [SEQ ID 175] PEPTIDE: FLLAGNKRNPQA [SEQ ID 176] RICE PROTEIN 4: Q0D750 - 3 - MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAE- QVRRDCCRQLAAV DDSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWLARSGY [SEQ ID 13] REGION: 102 to 124 - GGIYRELGAPDVGHPMSEVFRGC [SEQ ID 55] PEPTIDE: ELGAPDVGHPMSE [SEQ ID 177] RICE PROTEIN 5: P14614 - 4 - MATIAFSRLSIYFCVLLLCHGSMAQLFGPNVNPWHNPRQGGFRECRFDRLQAFEPLRRVRSEAGVTEYFDEKNE- QFQCTGTFVIRRVIEPQ GLLVPRYSNTPGMVYIIQGRGSMGLTFPGCPATYQQQFQQFLPEGQSQSQKFRDEHQKIHQFRQGDIVALPAGV- AHWFYNEGDAPVVA LYVFDLNNNANQLEPRQKEFLLAGNNNREQQMYGRSIEQHSGQNIFSGFNNELLSEALGVNALVAKRLQGQNDQ- RGEIIRVKNGLKLLRP AFAQQQEQAQQQEQAQAQYQVQYSEEQQPSTRCNGLDENFCTIKARLNIENPSHADTYNPRAGRITRLNSQKFP- ILNLVQLSATRVNLY QNAILSPFWNVNAHSLVYIVQGHARVQVVSNLGKTVFNGVLRPGQLLIIPQHYVVLKKAEHEGCQYISFKTNAN- SMVSHLAGKNSIFRAM PVDVIANAYRISREQARSLKNNRGEELGAFTPRYQQQTYPGFSNESENEALE [SEQ ID 14] REGION: 372 to 397 - HSLVYIVQGHARVQVVSNLGKTVFNG [SEQ ID 56] PEPTIDE: IVQGHARVQVVSNLGK [SEQ ID 178] PEPTIDE: IVQGHARVQVVSNL [SEQ ID 179] PEPTIDE: IVQGHARVQVVSN [SEQ ID 180] REGION: 464 to 486 - ARSLKNNRGEELGAFTPRYQQQT [SEQ ID 57] PEPTIDE: NNRGEELGAFTPR [SEQ ID 181] PEPTIDE: GEELGAFTPR [SEQ ID 182] REGION: 337 to 359 - LNSQKFPILNLVQLSATRVNLYQ [SEQ ID 58] PEPTIDE: FPILNLVQLSATR [SEQ ID 183] REGION: 210 to 293 - QMYGRSIEQHSGQNIFSGFNNELLSEALGVNALVAKRLQGQNDQRGEIIRVKNGLKLLRPAFAQQQEQAQQQEQ- AQAQYQVQYS [SEQ ID 59] PEPTIDE: SIEQHSGQNIFSGFNNELLSEALGVNALVAK [SEQ ID 184] PEPTIDE: LQGQNDQR [SEQ ID 185] PEPTIDE: SGFNNELLSEALGVNALVAK [SEQ ID 186] PEPTIDE: PAFAQQQEQAQQQEQAQAQY [SEQ ID 187] PEPTIDE: VAKRLQGQNDQRGEI [SEQ ID 188] PEPTIDE: ALVAKRLQGQNDQRGEI [SEQ ID 189] PEPTIDE: LQGQNDQRGEIIR [SEQ ID 190] REGION: 24 to 47 - AQLFGPNVNPWHNPRQGGFRECRF [SEQ ID 60] PEPTIDE: PNVNPWHNPRQGGF [SEQ ID 191] REGION: 164 to 186 - GVAHWFYNEGDAPVVALYVFDLN [SEQ ID 61] PEPTIDE: FYNEGDAPVVALY [SEQ ID 192] PEPTIDE: FYNEGDAPVV [SEQ ID 193] PEPTIDE: FYNEGDAPVVAL [SEQ ID 194] PEPTIDE: FYNEGDAPVVA [SEQ ID 195] REGION: 424 to 463 - YISFKTNANSMVSHLAGKNSIFRAMPVDVIANAYRISREQ [SEQ ID 62] PEPTIDE: TNANSMVSHLAGK [SEQ ID 196] PEPTIDE: AMPVDVIANAYR [SEQ ID 197] RICE PROTEIN 6: Q0DEV5 - 5 - MSALTTSQLATSATGFGIADRSAPSSLLRHGFQGLKPRSPAGGDATSLSVTTSARATPKQQRSVQRGSRRFPSV- VVYATGAGMNVVFVGA EMAPWSKTGGLGDVLGGLPPAMAANGHRVMVISPRYDQYKDAWDTSVVAEIKVADRYERVRFFHCYKRGVDRVF- IDHPSFLEKVWGK TGEKIYGPDTGVDYKDNQMRFSLLCQAALEAPRILNLNNNPYFKGTYGEDVVFVCNDWHTGPLASYLKNNYQPN- GIYRNAKVAFCIHNIS YQGRFAFEDYPELNLSERFRSSFDFIDGYDTPVEGRKINWMKAGILEADRVLTVSPYYAEELISGIARGCELDN- IMRLTGITGIVNGMDVSE WDPSKDKYITAKYDATTAIEAKALNKEALQAEAGLPVDRKIPLIAFIGRLEEQKGPDVMAAAIPELMQEDVQIV- LLGTGKKKFEKLLKSMEE KYPGKVRAVVKFNAPLAHLIMAGADVLAVPSRFEPCGLIQLQGMRYGTPCACASTGGLVDTVIEGKTGFHMGRL- SVDCKVVEPSDVKKV AATLKRAIKVVGTPAYEEMVRNCMNQDLSWKGPAKNWENVLLGLGVAGSAPGIEGDEIAPLAKENVAAP [SEQ ID 15] REGION: 571 to 608 - KGPAKNWENVLLGLGVAGSAPGIEGDEIAPLAKENVAA [SEQ ID 63] PEPTIDE: NWENVLLGLGVAGSAPGIEGDEIAPLAK [SEQ ID 198] PEPTIDE: NVLLGLGVAGSAPGIEGDE [SEQ ID 199] PEPTIDE: NWENVLLGLGVAGSAPGIEGDEIAPLAK [SEQ ID 200] REGION: 458 to 488 - RAVVKFNAPLAHLIMAGADVLAVPSRFEPCG [SEQ ID 64] PEPTIDE: FNAPLAHLIMAGADVLAVPSR [SEQ ID 201] PEPTIDE: FNAPLAHLIM [SEQ ID 202] PEPTIDE: FNAPLAHLIMAGADVLAVPSR [SEQ ID 203] REGION: 545 to 566 - KRAIKVVGTPAYEEMVRNCMNQ [SEQ ID 65] PEPTIDE: VVGTPAYEEMVR [SEQ ID 204] REGION: 93 to 147 - APWSKTGGLGDVLGGLPPAMAANGHRVMVISPRYDQYKDAWDTSVVAEIKVADRY [SEQ ID 66] PEPTIDE: TGGLGDVLGGLPPAMAANGHR [SEQ ID 205] PEPTIDE: YDQYKDAWDTSVVAEIK [SEQ ID 206] PEPTIDE: DAWDTSVVAEIK [SEQ ID 207] PEPTIDE: VMVISPR [SEQ ID 208] REGION: 305 to 413 - INWMKAGILEADRVLTVSPYYAEELISGIARGCELDNIMRLTGITGIVNGMDVSEWDPSKDKYITAKYDATTAI- EAKALNKEALQAEAGLPVDR KIPLIAFIGRLEEQK [SEQ ID 67] PEPTIDE: LTGITGIVNGMDVSEWDPSKDK [SEQ ID 209] PEPTIDE: VLTVSPYYAEELISGIAR [SEQ ID 210] PEPTIDE: EALQAEAGLPVDRK [SEQ ID 211] PEPTIDE: YDATTAIEAK [SEQ ID 212] PEPTIDE: IPLIAFIGR [SEQ ID 213] PEPTIDE: AGILEADR [SEQ ID 214] PEPTIDE: IPLIAFIGR [SEQ ID 215] REGION: 158 to 202 - RGVDRVFIDHPSFLEKVWGKTGEKIYGPDTGVDYKDNQMRFSLLC [SEQ ID 68] PEPTIDE: VFIDHPSFLEK [SEQ ID 216] PEPTIDE: GPDTGVDYKDNQM [SEQ ID 217] PEPTIDE: IYGPDTGVDYKDNQMR [SEQ ID 218] PEPTIDE: IYGPDTGVDYK [SEQ ID 219] REGION: 206 to 226 - LEAPRILNLNNNPYFKGTYGE [SEQ ID 69] PEPTIDE: ILNLNNNPYFK [SEQ ID 220] PROTEIN P02855 PEPTIDE: KNPQLQDLDI [SEQ ID 356] PROTEIN P07730 PEPTIDE: GQSTSQWQSSR [SEQ ID 357] PEPTIDE: QSTSQWQSSR [SEQ ID 358] PROTEIN P07728 PEPTIDE: QSTSQWQSSR (also in P07730) [SEQ ID 359] PROTEIN P13918 PEPTIDE: EEEEQGEEEINK [SEQ ID 360] PROTEIN P14323 PEPTIDE: PSTNPWHSPR [SEQ ID 361] PEPTIDE: AQAQDQYQQVQYSE [SEQ ID 362] PEPTIDE: SEAGVTEYFDEKNELFQCTGTFVIRR [SEQ ID 363] PEPTIDE: QAQAQDQYQQVQYSE [SEQ ID 363] PEPTIDE: GSMGLTFPGCPAT (also in P14614) [SEQ ID 365] PEPTIDE: GSMGLTFPGCPATY (also in P14614) [SEQ ID 366] PROTEIN P14614 PEPTIDE: LGAFTPRY [SEQ ID 367] PEPTIDE: LGAFTPRYQQ [SEQ ID 368] PEPTIDE: ALGVNALVAKRLQGQN [SEQ ID 369] PEPTIDE: LGAFTPRYQ [SEQ ID 370] PEPTIDE: GSMGLTFPGCPAT (also in P14323) [SEQ ID 371] PEPTIDE: GSMGLTFPGCPATY (also in P14323) [SEQ ID 372] PROTEIN P15838 PEPTIDE: SNNPFKFLVPARQS [SEQ ID 373] PROTEIN Q6K508 PEPTIDE: CAGVFVIRR [SEQ ID 374] PROTEIN Q6K7K6 PEPTIDE: GSPLQSPRGF [SEQ ID 375] PEPTIDE: RSSWQQQSY [SEQ ID 376] PEPTIDE: SFGGSPLQSPR [SEQ ID 377] PEPTIDE: YLPTKQLQPTW [SEQ ID 378] PEPTIDE: GKPRSSWQQQ [SEQ ID 379] PEPTIDE: FGGSPLQSPRG [SEQ ID 380]

PROTEIN Q9M3X6 PEPTIDE: LNLLGFGINAENNE [SEQ ID 381] ADDITIONAL PEPTIDES [SEQ ID 381 - 417] LRGFSK [381] GALMLPHYN GALMLPHYNSR VFDGVLRPG LQSQND LQSQNDQRGEI QSQNDQRGEIIHVK RGEIIHVK RLQSQNDQ RLQSQNDQRG [SEQ ID 390] RLQSQNDQRGEIIH MPMP PMPL LEPDNR GIARLAGTSSVIN RSQNIF PNSM GHPM HPMS FLPQHTD [SEQ ID 400] EWQINEK GPQQYAEWQINEK PQQYAEWQ RGPQQYA HNPR WHN WDP HPSF PGQLQSFLLSGNQNQQNYLSGF QLQSFLLSGNQNQQNYLSGFSK [SEQ ID 410] QSFLLSGNQNQQ PGQLQSFLLSGN QSFLLSGNQ QNQQNYLSGFSK YLRGFS PVEMPTLLYPS RGPQQYAEWQINE [SEQ ID 417] TVFDGVLRPGQL LDALEPDNR RLQSQNDQRGEIIHVK [SEQ ID 420] VLDLAIPVNRPGQL HGPVEMPYTLLYPSSK [SEQ ID 422] GYYGEQQQQPGMTR [SEQ ID 423] PROTEIN: P29835 - 5 - RICE SEEGYYGEQQQQPGMTR [SEQ ID 424] PROTEIN: P29835 - 5 - RICE PROTEIN: P29835 - 5 - RICE MASKVVFFAAALMAAMVAISGAQLSESEMRFRDRQCQREVQDSPLDACRQVLDRQLTGRERFQPMFRRPGALGL- RMQCCQQLQDVSRE CRCAAIRRMVRSYEESMPMPLEQGWSSSSSEYYGGEGSSSEQGYYGEGSSEEGYYGEQQQQPGMTRVRLTRARQ- YAAQLPSMCRVEPQQC SIFAAGQY [SEQ ID 353] PROTEIN: P02857 - 1 - PEA MAKLLALSLSFCFLLLGGCFALREQPQQNECQLERLDALEPDNRIESEGGLIETWNPNNKQFRCAGVALSRATL- QRNALRRPYYSNAPQEIFIQ QGNGYFGMVFPGCPETFEEPQESEQGEGRRYRDRHQKVNRFREGDIIAVPTGIVFWMYNDQDTPVIAVSLTDIR- SSNNQLDQMPRRFYLAG NHEQEFLQYQHQQGGKQEQENEGNNIFSGFKRDYLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIISPP- EKQARHQRGSRQEEDED EEKQPRHQRGSRQEEEEDEDEERQPRHQRRRGEEEEEDKKERGGSQKGKSRRQGDNGLEETVCTAKLRLNIGPS- SSPDIYNPEAGRIKTVTSL DLPVLRWLKLSAEHGSLHKNAMFVPHYNLNANSIIYALKGRARLQVVNCNGNTVFDGELEAGRALTVPQNYAVA- AKSLSDRFSYVAFKTNDR AGIARLAGTSSVINNLPLDVVAATFNLQRNEARQLKSNNPFKFLVPARESENRASA [SEQ ID 354] PROTEIN: P09918 - 14 - Pisum sativum MFSGVTGILNRGHKIKGTVVLMRKNVLDINSLTTVGGVIGQGFDILGSTVDNLTAFLGRSVSLQLISATKPDAT- GKGKLGKATFLEGIISSLPTLG AGQSAFKIHFEWDDDMGIPGAFYIKNFMQTEFFLVSLTLDDIPNHGSIYFVCNSWIYNAKHHKIDRIFFANQTY- LPSETPAPLVHYREEELNNLR GDGTGERKEWERIYDYDVYNDLGNPDSGENHARPVLGGSETYPYPRRGRTGRKPTRKDPNSESRSDYVYLPRDE- AFGHLKSSDFLTYGLKAVS QNVVPALESVFFDLNFTPNEFDSFDEVHGLYEGGIKLPTNILSQISPLPVLKEIFRTDGENTLKYPPPKVIQVS- RSGWMTDEEFAREMLAGVNPN VICCLQEFPPRSKLDSQIYGDHTSKISKEHLEPNLEGLTVEEAIQNKKLFLLDHHDSIMPYLRRINSTSTKAYA- TRTILFLNNNQNLKPLAIELSLPHP QGDEHGAVSYVYQPALEGVESSIWLLAKAYVIVNDSCYHQLVSHWLNTHAVVEPFVIATNRHLSCLHPIYKLLY- PHYRDTMNINSLARLSLVND GGIIEKTFLWGRYSMEMSSKVYKNWVFTEQALPADLIKRGMAIEDPSSPCGVKLVVEDYPYAVDGLEIWAIIKT- WVQDYVSLYYTSDEKLRQD SELQAWWKELVEVGHGDKKNEPWWPKMQTREDLIEVCSIVIWTASALHAAVNFGQYSYGGLILNRPTLSRRFMP- EKGSAEFEELVKSPQKA YLKTITPKFQTLIDLSVIEILSRHASDELYLGERDNPNWTSDKRALEAFKKFGNKLAEIEKKLTQRNNDEKLRN- RHGPVEMPYTLLYPSSKEGLTFR GIPNSISI [SEQ ID 355] BACTERIAL PROTEIN 1: P0C1U8 - 5 - MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQTQSSKQQTPKIQKGGNLKPLEQREHANVILPNN- DRHQITDTTNGHYAPV TYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAI- VKFSPNEQNKHIGEVVK PATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGG- VPNEFNGAVFINEN VRNFLKQNIEDIHFANDDQPNNPDNPDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA [SEQ ID 16] REGION: 92 to 117 - YIQVEAPTGTFIASGVVVGKDTLLTN [SEQ ID 70] PEPTIDE: APTGTFIASGVVVGKD [SEQ ID 221] Homologs of Pea protein 1 (SEQ ID 1) >gi|137584|sp|P08438.1|VCL_VICFA RecName: Full = Vicilin; Flags: Precursor [Vicia faba]>gi|22057| emb|CAA68559.1|vicilin [Vicia faba var. minor]>gi|383931031|gb|AFH56916.1| vicilin [Vicia faba] MAATTLKDSFPLLTLLGIAFLASVCLSSRSDQDNPFVFESNRFQTLFENENGHIRLLQKFDQHSKLLENLQNYR- LLEYKSKPHTIFLPQQTDADFIL VVLSGKAILTVLLPNDRNSFSLERGDTIKLPAGTIGYLVNRDDEEDLRVLDLVIPVNRPGEPQSFLLSGNQNQP- SILSGFSKNILEASFNTDYKEIEK VLLEEHGKEKYHRRGLKDRRQRGQEENVIVKISRKQIEELNKNAKSSSKKSTSSESEPFNLRSREPIYSNKFGK- FFEITPKRNPQLQDLNIFVNYVEI NEGSLLLPHYNSRAIVIVTVNEGKGDFELVGQRNENQQGLREEYDEEKEQGEEEIRKQVQNYKAKLSPGDVLVI- PAGYPVAIKASSNLNLVGFGI NAENNQRYFLAGEEDNVISQIHKPVKELAFPGSAQEVDTLLENQKQSHFANAQPRERERGSQEIKDHLYSILGS- F [SEQ ID 222] >gi|502105533|ref|XP_004492829.1| PREDICTED: vicilin-like isoform X1 [Cicer arietinum] ChickPea MAIKARFPLLVLLGIVFLASVCAKSDKENPFFFKSNNCQTLFENENGHVRLLQRFDKRSQLFENLQNYRLMEYN- SKPHTLFLPQHNDADFILVVL RGRAILTVLNPNDRNTFKLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVNRPGQFQSFSLSGNENQQSYF- QGFSKKILEASFNSDYEEIERV LLEEQEQKPEQRRGHKGRQQSQETDVIVKISREQIEELSKNAKSNCKKSVSSESEPFNLRSRSPIYSNRFGNFF- EITPEKNPQLKDLDIFVNSVEIK EGSLLLPHFNSRATVILVVNEGKGEVELVGLRNENEQENKKEDEEEEEDRNVQVQRFQSKLSSGDVVVIPASHP- FSINASSDLFLLGFGINAQN NQRNFLAGEEDNVISQIQRPVKEVAFPGSAEEVDRLLKNQRQSHFANAQPQQKRKGSQRIRSPF [SEQ ID 223] >gi|29539109|emb|CAD87730.1| allergen Len c 1.0101 [Lens culinaris] Lentil SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTDADFILVVLS- GKAILTVLNSNDRNSFNLERGDTI KLPAGTIAYLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLE- EQEQKSQHRRSLRDKRQEITNE DVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKE- GSLLLPNYNSRAIVIVTVNEGKGDF ELVGQRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAKNNQR- NFLAGEEDNVISQIQRPV KELAFPGSSREVDRLLTNQKQSHFANAQPLQIE [SEQ ID 224] Homologs of Pea protein 2 (SEQ ID 2) >gi|29539111|emb|CAD87731.1| allergen Len c 1.0102 [Lens culinaris] SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDADFILVVLS- GKAVLTVLNSNDRNSFNLERGDT IKLPAGTIAYLANRDDNEDLRVLDLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLL- EDQEQEPQHRRSLRDRRQEINK ENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIK- EGSLLLPNYNSRAIVIVTVNEGKGY FELVGQRNENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQRNF- LAGEEDNVISQIQRPVKEL AFPGSSREVDRLLTNQKQSHFANAQPLQIE [SEQ ID 225] >gi|1297072|emb|CAA96514.1| vicilin precursor [Vicia narbonensis] MAAITMKVSFPLLMLLGISFLASVCVSSRSDQENPFIFKSNKFQTLFENDNGHIRLLQKFDERSKILENLQNYR- LLEYKSKPRTIFLPQQTNADFIL VVLSGKAILTVLKPDDRNSFNLERGDTIKLPAGTIAYLVNKDDNEDLRVLDLAIPVNGPDQLQSFLLSGSENQQ- SILSGFSKSVLEASFNTGYEEIE KVLLEEREKETQHRRSLRDKRQHSQDEDVIVKLSRGQIEELSRNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG- KFFEITPEKNPQLQDLDVLVNSV EIKEGSLLLPHYNSRAIVIVTVNDGKGDFEIVGQRNENRQGQRKEDDEEEEQGDENTNTQVQNYKAKLSRGDVF- VIPAGHPVSIKASSNLDLLG FGINAKNNQRNFLAGEEDNVISQIDRPVKELAFPGSAQEVDRLLENQKQSHFANAQPQQRERGSHETRDHLSSI- LDAF [SEQ ID 226] >gi|28629838|gb|AAO45103.1| beta-conglycinin alpha' subunit [Glycine max] QYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGD- ALRVPAGTTYYVVNPDNDE NLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVI- VEISKKQIRELSKHAKSSSRKTIS SEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIEL- VGIKEQQQRQQQEEQPLEVRK YRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENL- IKSQSESYFVDAQPQQKEEGN KGRKGPLSSILRAFY [SEQ ID 227] Homologs of Pea protein 3 (SEQ ID 3) >gi|483449|emb|CAA83677.1| legumin A [Vicia sativa] MAKLLALSLSFCFLLFSSCFALREQSQQNECQLERINALEPDNRIESEGGLIETWNPNNRQFRCARVALSRATL- QRNALRRPYYSNAPQEIYIQQ GNGYFGMVFPGCPETHEEPQQSEQGEGRRYRDSHQKVNRFREGDIIAVPTGIAFWMYNDQDTPVIAISLTDTGS- SNNQLDQMPRRFYLAG NQEQEFLRYQHQQGGKQEQDNDGNNIFSGFKRDFLEDAFNVNRHIVDRLQGRNEDEEKGAIVKVKGGLSIIAPP- ERQARHERGSRQEEDED EKEERQPSHHKSRRDEDEDDKEKRHSQKGQSRRQGDNGLEETVCTAKLRANIGSSPSPDIYNPQAGRIKTVTSL- DLPVLRWLKLSAEHGSLHK NAMFVPHYNLNANSVIYALKGRARLQVVNCNGNTVFDGELEAGRALTVPQNYAVAAKSLSERFTYVAFKTDDRA- SIARLAGTSSVIDDLPLDV VAATFNMQRNEARQLKSNNPFKFLVPPRQSEMRASA [SEQ ID 228] >gi|657379551|gb|KEH23931.1| legumin A2 [Medicago truncatula] MAKLLALSLSLCFLLFSGCFAIREHQPHQKQQPQQNECQLEQLNALEPDNRIESEGGIIETWNPNNRQFRCAGV- ALSRCTLQRNSLRRPFYSNA PQEIFIQQGSGYFGMVFPGCPETFEEPQESEQRESRRIRESEQGESRRIRESEQGEGRRFRDSHQKVNRFREGD- LIAVPTGTVFWMYNDQDTP VIAVSLIDTGSFQNQLDEMPRRFYLAGNQEQEFLQYQQQQVRGRGEQRRGREQQENEGGNIFSGFKRDFLEDAL- NVNRHIVDRLQGRNEDE EKGAIVKVRGGLSFVTPPERQSRHQGGSIIEEDEDEEDEWRRPHHQKSRRGEEEERPCRRGQKCERSNGLEETI- CTARLRQNIGSSSSPDIYNPE AGRIKTVTSFDLPALRWLRLSAEHGTLHRNAMFVPHYNLNANSAIYALRGRARLQVVNCNGNTVFDGELEAGRV- LIVPQNFAVAAKSMSDRF QYVSFKTNDNAAIARLAGTQSTLSGVPMDVLAATYNMDRNEARQLKNNNLYKFLVPPRESERRAAA [SEQ ID 229] >gi|206712292|emb|CAR78996.1| legumin storage protein 5 [Lotus japonicus] MAYKLFALSLSFCFLLFGGCFAIRQQSQQQNECQLERLNALKPDNRIESEAGYIETWNPTNNQFRCAGVALSRC- TLRRNGLKRPSYSNAPQEIFI QQGSGIFGMIFPGCPETVEEPFESDQQGRRDRHQKVNRFREGDVIAVPPGVVFWMYNEEETPVIAVSLIDTGSY- LNQLDQMPRRFYLSGNQ EQEFLQYQRQEVRGREEENQGGNIFSGFGGEFLEDALNIDRNIVHKLQGRDEEQDKGAIVRVKGGLSVITPPER- QSHRRGSEEEEDEEEDRPS RHQSRGGSRRNGLEETICTVRLRMNIGKSSSPDIFNPQAGRIKTATGFDFPALRFLKLSAEHGSLNRNAMVVPH- YNLNANSIIYALRGRAWIQV VNCKGNRIFDGELEEGQVLIVPQNFVVAARSMSDKFNYVAFKTNDMPTMAKLAGATSEIQAMPLEVIQNAFNLE- REQAKQVKFNNRFNFLV PPREQSQRRASA [SEQ ID 230] Homologs of Pea protein 4 (SEQ ID 4) >gi|164512526|emb|CAP06312.1| cvc [Pisum abyssinicum] MATTVESRFPLLLFPGIIFLASVCVTYANYDEGSETRVPGQRERGRQEGEKEEKRHGEWRPSYEKEEDEEEKQK- YRYQREKEDEEEKQKYRYQR EKKEEKEVQPGRERWEREEDEEQVDEEWRGSQRRQDPEERARLRHREERTKRDRRHKREGEEEERSSESQEQRN- PFLFKSNKFLTLFENENG HIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDADLILVVLNGKAILTVLSPNDRNSYNLERGDTIK- IPAGTTSYLVNQDDEEDLRVVD FVIPVNRPGKFEAFGLSENKNQYLRGFSKNILEASLNTKYETIEKVLLEEQEKKPQQLRDRKRRQQGGERDAII- KVSREQIEELRKLAKSSSKKSLPS EFEPFNLRSHKPEYSNKFGKLFEITPEKKYPQLQDLDILVSCVEINKGALMLPHYNSRAIVVLLVNEGKGNLEL- LGLKNEQQEREDRKERNNEVQ RYEARLSPGDVVIIPAGHPVAISASSNLNLLGFGTNAENNQRNFLSGSDDN [SEQ ID 231] >gi|164512538|emb|CAP06318.1| cvc [Lathyrus annuus] MATTIKSRFPLLLLLGIIFLASVCVTWANYDEGSEPRVPGQRERGRQEGEKEEKRHGEWRPSYEEEYDEGLEPK- VPGKRERGRQEGEKEEKRHE EWRPSYEKEEDEEEKQKYNYQREKKEHKEVQPGRERWERKQDEKQVEEDEEPGEEQWRGSKRHEDPEERARLRH- REEKTKSYVEDNEETSS KEGRNPFLFKSNKFLTLFENENGHIRRLQRFDERSDIFENLQNYRLVEYRAKPHTMFLPQHIDADLILVVLNGK- AILTVLSPNDRNSYNLERGDT VKLPAGTTSYLVNQDDEEDLRVVDLAIPVNRPGKFEAFGLSANKNQYLRGFSKNILEASLNTKYETIEKVLLEE- RRDQKGRQQGQETNAIVKVSR EQIEELRKLAKSSSKKSLLSESEPLNLRSQNPKYSNKFGKFFEITPQKKYPQLQDLDVSISCVEINKGALLLPH- YNSRSIGILLVNEGKGNLELVGFKN EQQRQRENEETNKKLQRYEARLSSGDVVVIPEGHPVAISASSNLNLLGFGINAANNQRNFLTGSDDN [SEQ ID 232] >gi|164512558|emb|CAP06328.1| cvc [Vicia villosa]

MATTIKSRFPVLLLLGIIFLTSVCVTYANYDEGREPSVPGQRERGRQEGEKEEKRHGEWRPSEEDEEEKYKYEE- GRVPGQRERGRQEGEKEEKR HGKWRPSEEEDEEEKYRYEEGSEPRGPGQRETGRQEGEKEKQRPEREPSYEKEEDEEEKQKYQYHREKKEQREV- RPGRERFERHEDEEQWRG IQRHEDPEERARERYRAEIAKRQVEEEREERDIPHEREQRNPFLFKSNKFQTLFQNENGYIRRLQRFDKRSDLF- ENLQNYRLVEYRAKPHTIFLPQ HIDADLIIVVLSGRAILTVLSPDDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRVVDLAIPVNRPGKVESFL- LSGNKNQYLRGFSKNILEASFNT NYETIERVLLEEQDKESQQSIGQKRRSQRQETNALVKVSREQLEDLKRLAKSSSQEGLSSQFEPINLRSQNPKY- SNKFGKVFEITPEKKYPQLQDL DLFVSSVDIKEGALMLPHYNSRAIVVLLVNEGRGNLELVGLKNEQQEQREKEDEQQERNNQVQRYEARLSPGDV- VIIPAGHPVAVRASSDLNL LAFGINAENNQRNFLAGSDDN [SEQ ID 233] Homologs of Pea protein 5 (SEQ ID 5) >gi|357507721|ref|XP_003624149.1| Provicilin [Medicago truncatula] >gi|87162569|gb|ABD28364.1| Cupin, RmlC-type[Medicago truncatula] >gi|355499164|gb|AES80367.1| vicilin 47 kDa protein [Medicago truncatula] MAIKAPFQLLMLLGIFFLASVCVSSRDDRHDQENPFFFNANHFQTLFENENGHIRLLQRFDKRSKIFENLQNYR- LLEYHSKPHTLFLPQHNDAD FILAVLSGKAILTVLNPDNRNSFNLERGDTIKLPAGSIAYLANRDDNEDLRVLDLAIPVNRPGKFQSFSLSGSQ- NQQSFFSGFSKNILEAAFNANY EEIERVLIEEHEQEPQHRRGLRKDRRQQSQDSNVIVKVSREQIEELSRHAKSSSRRSGSSESAPFNLRSREPIY- SNEFGNFFEITPEKNPQLKDLDIL VNYAEIREGSLLLPHFNSRATVIVVVDEGKGEFELVGQRNENQQEQREEDEQQEEERSQQVQRYRARLSPGDVY- VIPAGHPTVVSASSDLSLL GFGINAENNERNFLAGEEDNVISQIERPVKEVAFPGSAQDVESLLKNQRQSYFANAQPQQREREEGRSQRQREL- ISSILGVF [SEQ ID 234] >gi|164512560|emb|CAP06329.1| convicilin [Vicia peregrina] MATTFKSRFSLLLLLGIIFLAFVCVTCANYDEGSEPRVPGQRERGRQEGEKEEQSRERHPQREPSREKEEDEEE- KQKYDEGTEPRVPGQRERGR QEGEKEEQRRERHPGQREPSQEEDEEREESDRRQEGSSKSEEQRNPFLFKSNKFLTLFQNGNGHIRLLQRFDKR- SDLFENLQNYRLLEYRAKPH TIFLPQHIDADLILVVLSGRAILTVLSPDDRNSYNLERGDTIKLPAGTTSYPLNQDDEEDLRVVDLAISVNRPG- KVESFNLSGNKNQYLRGFSENIL EASFNTKYETIEKVLLEEQDKESQQPRGQRLQRQETNALVKVSREQVEELKRLARTSSKKGVSSEFEPFNLRSH- GPKYSNKFGKFFEITPEKKYPQ LQDLDISVSSVEINEGALFLPHYNSRAIVVVLVDEGKGNLELVGFKNEQQEQREKEDEQEERNKQVQRYEAKLS- PGDVVIIPAGHPVAVSASSN LNLLGFGINAENNQRNFLTGSDDN [SEQ ID 235] >gi|164512562|emb|CAP06330.1| convicilin [Vicia lutea] MATTIKLRFPLLLLLGVILLASVCVTCANYDEGSEPRVPGRPEGEKEEKHRGKLRPSYEKEEDEGEKQRYHYEK- KEQKEAQPRREKKEQKEEEKQ VEEESRESQRYEDPGERARERYRAEIIKRQVEKEREERDRRHQREGEEEEGSSKSRNPFLFKSNNFLTLFENEN- GHIRLLQRFDKRSDLFENLQNY RLVEYRAKPHTIFLPQHIDADLILVVLSGKAILTVLSPNNRNSYNLKRGDTIKLPAGTTSYLLNSDDEEDLRMV- DLAISVNRPGKVESFNLSGNKN QYLRGFSKNILEASFNTKYETIEKVLLEEQDKESQQSIGQKRISQRQETNALVKVSREQIEEPKRLARSSSRKG- VSSEFEPINLRSQRPKYSNKFGKF YEISPEKKYPQLQDLDVSVSSVEINEGALLLPHYNSRAIVTVLVNEGKGNLELIGFQNEQQGQREKEDEQQHER- NKQVQRYDARLSSGDVVIIP AGHPVAVSASSNLDLLGFGINAENSQRNFLTGSDDN [SEQ ID 236] Homologs of Rice protein 1 (SEQ ID 6) >gi|573919041|ref|XP_006647142.1| PREDICTED: glutelin type-B 4-like [Oryza brachyantha] MATTTFSRFSIYFCVLLLCHGSMAQLFSPTLNPWHSSRRGGSRDCRFDRLQAFEPLRRVRSEAGVTEYFDERNE- QFQCTGTFVIRRVIEPQGLL VPRYTNTPGVVYIMQGRGSMGLTFPGCPATYQQQFQQFLPEGQSQSQKFRDEHQKIHQFRQGDIVALPAGVAHW- FYNEGDTPVVALYVFD INNSANQLEPRQKDFLLAGNNNREQQVYGRSIEKHSGQNIFSGFNHELLSEALGISTLAAKRLQGQNDHRGEII- RVRNGLQLLKPTFTQQQEQ AQSQYQVQYSEKQQESTRCNGLDENFCTINARLNIENPSRADTYNPRAGRITHLNNQKFPILNLVQMSATRVNL- YQNAILSPYWNVNAHSLV YMVQGHARVQVVSNLGKTVFNSVLRPGQLLIIPQHYVVLKKAEREGCQYIAFKTNANSIVSQLAGKNSILRAMP- VDVVANAYRISREQARDLK NNRGEELGAFTPKFEQQSYPGLSNESESEASE [SEQ ID 237] >gi|2764800|emb|CAA54153.1| 12s globulin [Avena sativa] MATTSFPSVLFYSCIFLLYNGSMAQLFGQSFTPWQSSRQGGLKGCKFDRLQAFEPLRQVRSQAGVTEYFDEQNE- QFRCTGVFVIRRVIEPQGL LLPQYHNAPGLVYILQGRGYTGLTFPGCPATFQQQFQPFDQAQDQSQSHLKDEHQRVHRFKQGDVIALPAGIVH- WGYNDGDAPVVAIYVF DVNNNANQLEPRQKEFLLAGNNKEDQQFGQNIFSGFNIQLLSEALGISQQAAQRIQSQKEQRGEIIRVTQALQF- LKPTMSQQELVEHQAYQP IQSQEGQSTQYQVGQSTQYQEGQSTQYQAGQSQDRSFNGLEENFCSLEARQNIGNPKRADTHNPRAGRITRLHG- QNFPILNLVQMSATRV NLYQNAILSPFWNINAHSVVYMIQGHAQVQVVNNNGQTVFNDRLRQGQLLIVPQHYVVLKKAEREGCQYISFKT- NPNSMVSHIAGKSSILRA LPVDVLANAYRISRQEARNLKNNRGQESGVFTPKFTQTSFQPYPEGEDESSLTNKASE [SEQ ID 238] >gi|357130026|ref|XP_003566659.1| PREDICTED: 12S seed storage globulin 1-like [Brachypodium distachyon] >gi|357130028|ref|XP_003566660.1| PREDICTED: 12S seed storage globulin 1-like [Brachypodium distachyon] MAHTSFSSVLSYFCIFLLFHGSMAQVPGQGSTWQSPRQGGSRECSFDRLQTIEPLTQVRSQAGLTEYFDEQNEQ- FRCAGVSVIRRVIEPRGLLL PRYHNTPGLVYILEGSGFVGLAFPGCPETFLEQFQQSRQTQSTLGQSQCQSQSQKLGDVHQRVHQFTQGDVVAL- PAGVAHWFYNGGDAPV VAVYVFDVNNNANQLEPRQKEFLLAGNYNGVLQSGRNILNGLNAQLLSQAFGINEQTSRIIQNQNDGRGEIVRV- EYGLQFLTPVVTQQQQK QPFLPIEPQEGQSSRNGLEENFCSLEPRQNIEDPNRADTYNPRAGSIARLNGQNFPILNLVQMSATRVNLQKNA- IVSPFWNINAHSVVYVIQG QASVQVVNNQGRNVFNGLLRRGQLLIIPQNYVVLKKAESEGYQYIAFKTNANSMVSHIAGKNSILRALPVDVIA- NAYRISRQEAQNLKNNRGE EIGVLTPNFPQSSCQSYPIGDVDSSSTPKAQE [SEQ ID 239] Homologs of Rice protein 2 (SEQ ID 7) >gi|222622792|gb|EEE56924.1| hypothetical protein OsJ_06602 [Oryza sativa Japonica Group] MAQFSFGGSPLQSPRGFRGDQDSRHQCRFEHLTALEATHQQRSEAGFTEYYNIEARNEFRCAGVSVRRLVVESK- GLVLPMYANAHKLVYIVQ GRGVFGMALPGCPETFQSVRSPFEQEVATAGEAQSSIQKMRDEHQQLHQFHQGDVIAVPAGVAHWLYNNGDSPV- VAFTVIDTSNNANQL DPKRREFFLAGKPRSSWQQQSYSYQTEQLSRNQNIFAGFSPDLLSEALSVSKQTVLRLQGLSDPRGAIIRVENG- LQALQPSLQVEPVKEEQTQA YLPTKQLQPTWLRSGGACGQQNVLDEIMCAFKLRKNIDNPQSSDIFNPHGGRITRANSQNFPILNIIQMSATRI- VLQNNALLTPHWTVNAHT VMYVTAGQGHIQVVDHRGRSVFDGELHQQQILLIPQNFAVVVKARREGFAWVSFKTNHNAVDSQIAGKASILRA- LPVDVVANAYRLSREDS RHVKFNRGDEMAVFAPRRGPQQYAEWQINEK [SEQ ID 240] >gi|218190679|gb|EEC73106.1| hypothetical protein Osl_07091 [Oryza sativa Indica Group] MAQFSFGGSPLQSPRGFRGDQDSRHQCRFEHLTALEATHQQRSEAGFTEYYNIEARNEFRCAGVSVRRLVVESK- GLVLPMYANAHKLVYIVQ GRGVFGMALPGCPETFQSVRSPFEQEVATAGEAQSSMQKMRDEHQQLHQFHQGDVIAVPAGVAHWLYNNGDSPV- VAFTVIDTSNNANQ LDPKRREFFLAGKPRSSWQQQSYSYQTEQLSRNQNIFAGFNPDLLSEALSVSKQTVLRLQGLSDPRGAIIRVEN- GLQALQPSLQVEPVKEEQTQ AYLPTKQLQPTWSRSGGACGQQNGLDEIMCAFKLRKNIDNPQSSDIFNPHGGRITRANSQNFPILNIIQMSATR- IVLQNNALLTPHWTVNAH TVMYVTAGQGRIQVVDHRGRSVFDGELHQQQILLIPQNFAVVVKARREGFAWVSFKTNHNAVDSQIAGKASILR- ALPVDVVANAYRLSREDS RRVKFNRGDEMAVFAPRRGPQQYAEWQINEK [SEQ ID 241] >gi|573922051|ref|XP_006648611.1| PREDICTED: glutelin type-A 1-like [Oryza brachyantha] MVDMSIVVPVCLTIFLLSQVCIAQVSFDGSPLYSSRGFRGGSASQQQCRFEHLAALEVTHQEKSEAGSIEYYNT- EARDEFRCARVSARRLVIESR GLVLPVYANAHKLLYIVQGRGVFGMALPGCPETFQSVRSAFEMATGDAESSTRKLRDEHQKIHQFRQGDVIAVP- PGVAHWLYNNGDSPVVA FSVIDFGNNANQLDPKPREFFLAGKPWGWQQVQYSYQSEQQSKHQNIFAGFNPDLLAEALSVSRQTAMRLQELN- DQRGAIIRVEQGLQLAL DPSFQAEQEQEEQPQEYLSSQQQQPTWSQRSGACVQNNGLDEIMCAFKVSKNINSAQSTDIFNPRGGRITRANS- QNFPVLNIIQMSATRTV LQNNALLTPHWTVNAHTVMYVTAGQGRIQVVDHRGRTVFDGELRQQQILLIPQNFAVAVKARHEGFSWVSFKTS- HNAIDSQIAGKGSILRA LPVDVLAKAYMLSREESRTLKYNRADETLVFAPRPEIQLYAESEK [SEQ ID 242] Homologs of Pea protein 6 (SEQ ID 8) >gi|164512534|emb|CAP06316.1| cvc [Pisum fulvum] MATTTKSRFPLLLLLGIIFLASVVCVTYANYDEGSEPRVPGRRERGRQEGEKEEKRHGEWRPSYEKEEDEEEGQ- RERGRQEGEKEEKRHGEWG PSYEKQEDEEEKQKYRYQREKEDEEEKQKYRYQREKKEQKEVQPGRERWEREEDEEHVDEEWRGSQRHEDPEER- ARLRYREERTKRDRRHQ REGEEEERSSESQERRNPFLFKSNKFQTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHI- DADLILVVLSGKAILTVLSPNAR NSYNLERGDTIKLPAGTTSYLVNQDDEEDLRLVDLVIPVNGPGKFEAFDLSKNKNQYLRGFSKNILEASYNTKY- ETIEKVLLEEQEKTDAIVKVSRE QIEELRKHAKSSSKKIFPSEFEPINLRNHKPEYSNKFGKLFEITPEKKYPQLQDLDIFVSCVEINEGALMLPHY- NSRAIVVLLVNEGKGNLELLGLEN EQQEREDRKERNNEVQRYEARLSPGDVVIIPAGHPVAITASSNLNLLAFGINAENNQRNFLSGSDDN [SEQ ID 243] >gi|164512526|emb|CAP06312.1| cvc [Pisum abyssinicum] MATTVESRFPLLLFPGIIFLASVCVTYANYDEGSETRVPGQRERGRQEGEKEEKRHGEWRPSYEKEEDEEEKQK- YRYQREKEDEEEKQKYRYQR EKKEEKEVQPGRERWEREEDEEQVDEEWRGSQRRQDPEERARLRHREERTKRDRRHKREGEEEERSSESQEQRN- PFLFKSNKFLTLFENENG HIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDADLILVVLNGKAILTVLSPNDRNSYNLERGDTIK- IPAGTTSYLVNQDDEEDLRVVD FVIPVNRPGKFEAFGLSENKNQYLRGFSKNILEASLNTKYETIEKVLLEEQEKKPQQLRDRKRRQQGGERDAII- KVSREQIEELRKLAKSSSKKSLPS EFEPFNLRSHKPEYSNKFGKLFEITPEKKYPQLQDLDILVSCVEINKGALMLPHYNSRAIVVLLVNEGKGNLEL- LGLKNEQQEREDRKERNNEVQ RYEARLSPGDVVIIPAGHPVAISASSNLNLLGFGTNAENNQRNFLSGSDDN [SEQ ID 244] >gi|164512558|emb|CAP06328.1| cvc [Vicia villosa] MATTIKSRFPVLLLLGIIFLTSVCVTYANYDEGREPSVPGQRERGRQEGEKEEKRHGEWRPSEEDEEEKYKYEE- GRVPGQRERGRQEGEKEEKR HGKWRPSEEEDEEEKYRYEEGSEPRGPGQRETGRQEGEKEKQRPEREPSYEKEEDEEEKQKYQYHREKKEQREV- RPGRERFERHEDEEQWRG IQRHEDPEERARERYRAEIAKRQVEEEREERDIPHEREQRNPFLFKSNKFQTLFQNENGYIRRLQRFDKRSDLF- ENLQNYRLVEYRAKPHTIFLPQ HIDADLIIVVLSGRAILTVLSPDDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRVVDLAIPVNRPGKVESFL- LSGNKNQYLRGFSKNILEASFNT NYETIERVLLEEQDKESQQSIGQKRRSQRQETNALVKVSREQLEDLKRLAKSSSQEGLSSQFEPINLRSQNPKY- SNKFGKVFEITPEKKYPQLQDL DLFVSSVDIKEGALMLPHYNSRAIVVLLVNEGRGNLELVGLKNEQQEQREKEDEQQERNNQVQRYEARLSPGDV- VIIPAGHPVAVRASSDLNL LAFGINAENNQRNFLAGSDDN [SEQ ID 245] Homologs of Pea protein 7 (SEQ ID 9) >gi|164512536|emb|CAP06317.1| cvc [Lathyrus hirsutus] MAIIIKSRFPLLLLLGIIFLASVCATWANYDEGSEPRVPGQRERGRQEGEKAEKSHEKWRPSYEEEYDEGSEPR- VPGKRERGRQEGEKEEKRHGE WRPSHEEEYDEGSEPRVPTHGERGRQEGEKEEKRHEEWRPSYEKEEDEEEKEKYKYQREKKEQKEVQPGREKWE- RKQDEKHVEEDEDQEEE QWRGSKRREDPEERARLRYREERTKSNVEEETEERRNPFLFKSNKFLTLFENENGHIRRLQRFDERSDIFENLQ- NYRLVEYKAKPHTMFLPQHID ADLIIVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRVVDLAIPVNRPGKFEAFGLSA- NKNQYLRGFSKNILEAFLNTKY ETIEKVLLEEQERRDRKGRQQGQETNAIVKVSREQIEELRKLAKSSSKKSLLSESEPINLRSQNPKYSNKFGKL- FEITPEKKYPQLQDLDVSISCVEI NEGAPLLPHYNSRAIVLLLVNEGKGNLELVGFKNEQQRQRENEERNKKVQRYEARLSPGDVVVIPAGHPVAISA- SLNLNLVGFGVNAENNQR NFLTGSDDN [SEQ ID 246] >gi|164512542|emb|CAP06320.1| cvc [Lathyrus cicera] MATIIKSRFPLLLLLGIIFLASVCVTLANYDEGSEPRVPAQRERGRQEGEKEEKRHGEWRPSHEKEYDEGSEPR- VPGRRERGRQEGEKEEKRHGE WRPSYEKEYDEGSEPRVPGRRERGRQEGEKEEKRHGEWRPSYEKEYDEEEKQKYQYEREKEEQKEVQPGRERWE- RKEDEEKEEDQWRGSQ RHEDPEERARLRYRKERTKKYVEEDTEETSSESQGRRNPFLFKSNKFLTLFENENGYIRRLQRFDERSDIFENL- QNYRLVEYRAKPHTIFLPQHIDA DLILVILNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNEDDEEDLRVVDLVIPVNRPGKFEAFDLNQY- LGGFSKSVLEASLNTKYETIEKVL LEEQQKQGQETNAIVKVSREQIEELRKLAKSSSKKSLLSELEPVNLRSHSPKYSNKFGKFFEITPEKKYPQLQD- LDVSISCVEINEGALLLPHYNSRA IVVVLVNEGKGNLELLGVQNEDEQQERKERNKEVQRYEARLSPGDVVIIPSGHPVAVSASSNLNLLGFGINAEN- NQRNFLSGSDDN [SEQ ID 247] >gi|164512544|emb|CAP06321.1| convicilin [Lathyrus sativus] MATIIKSRFPLLLLLGIIFLASVCVTYANYDEGSEPRVPAQRERGRQEGEKEEKRHGEWRPSSEKEYDEGSEPR- VPGRRERGRQEGEKEEKRHGE WRPSYEKEYDEEEKQKYQYEREKKEQKEVEPGRERWERKEDEEKEEDQWRGSQRHEDPEERARLRYRKERTKKY- VEEDTEETSSESQGRRNP FLFKSNKFLTLFENENGYIRRLQRFDERSDLFENLQNYRLVEYRAKPHTIFLPQHIDADLILVILNGKAILTVL- SPNDRNSYNLERGDTIKLPAGTTS YLVNEDDEEDLRVVDLVIPVNRPGKFEAFDLNQYLGGFSKSVLKASLNTKYETIEKVLLEEQQKQGQETNAIVK- VSREQIEELRKLAKSSSKKSLLS ELEPVNLRSHSPKYSNKFGKFFEITPEKKYPQLQDLDVSISCVEINEGALLLPHYNSRAIVVLLVNEGKGNLEL- LGVQDEDEQQERKKRNKEVQRY EARLSPSDVVIIPAGHPVAVSASSNLNLLGFGINAENNERNFLSGSDDN [SEQ ID 248] Homologs of Rice protein 3 (SEQ ID 10) >gi|573918992|ref|XP_006647120.1| PREDICTED: glutelin type-B 2-like [Oryza brachyantha] MATTVFSRFSTYFCVLLLCHGSMAQLFNPSTNPWHNPRQGSSRECRFDRLQPFEPLRKVRSEAGVTEYFDEKNE- LFQCTGTFVIRRVIQPQGLL VPRYTNAPGLVYIIQGRGSIGLTFPGCPATYQQQFQQFLPQEQSQSQKFRDEHQKIHQFRQGDIVALPAGVAHW- FYNDGDAPVVAVYVYDV KNSANQLEPRQREFLLGGNNMRAQQVYGSSAEQHSRQNIFSGFGVEILSEALGISTVTTKRLQSQNDQRGEIIH- VKNGLQFLKPTLTQQQEQA QAQYQEVQYSEQQQTSSRWNGLDENFCTIKARMNIENTSRADTYNPRAGRTTSLNSQKFPILNLVQMSATRVNL- YQNAILSTFWNVNAHSL VYTIQGRARVQVVSNFGKTVFDGELRPGQLLIIPQHYVVLKKAQREGFRYIAIKTNANAFVSQLVGKNSVFRSL- PVDVIANVYRISREQARSLKN NRGEEHGAFAPRSQQQSYPGFSNQSESETSE [SEQ ID 249] >gi|573919041|ref|XP_006647142.1| PREDICTED: glutelin type-B 4-like [Oryza brachyantha] MATTTFSRFSIYFCVLLLCHGSMAQLFSPTLNPWHSSRRGGSRDCRFDRLQAFEPLRRVRSEAGVTEYFDERNE- QFQCTGTFVIRRVIEPQGLL

VPRYTNTPGVVYIMQGRGSMGLTFPGCPATYQQQFQQFLPEGQSQSQKFRDEHQKIHQFRQGDIVALPAGVAHW- FYNEGDTPVVALYVFD INNSANQLEPRQKDFLLAGNNNREQQVYGRSIEKHSGQNIFSGFNHELLSEALGISTLAAKRLQGQNDHRGEII- RVRNGLQLLKPTFTQQQEQ AQSQYQVQYSEKQQESTRCNGLDENFCTINARLNIENPSRADTYNPRAGRITHLNNQKFPILNLVQMSATRVNL- YQNAILSPYWNVNAHSLV YMVQGHARVQVVSNLGKTVFNSVLRPGQLLIIPQHYVVLKKAEREGCQYIAFKTNANSIVSQLAGKNSILRAMP- VDVVANAYRISREQARDLK NNRGEELGAFTPKFEQQSYPGLSNESESEASE [SEQ ID 250] >gi|109894635|gb|ABG47337.1| glutelin precursor [Zizania latifolia] MNMATINGPTIFFTVCLFLLCHGSLAQLLGQSTSQWQSSHRGSSRQCRFDRLQAFEPVRSVRSQAGTTEFFDAS- NELFQCAGVSIVRRIIEPRG LLLPQYTNGATIMYIIQGRGITGQTFPGCPESYQQQFQQSMQAQLTGSQSQSQKFKDEHQKINRFRQGDVIALP- AGVAHWCYNDGEVPVVA IYVIDINNAANQLDPRQRDFLLAGNMRSPQAYRREVENQSQNIFSGFSAELLSEALGISTGVARQLQCQNDQRG- EIVRVEHGLSLLQPYASLQE QEQKQEQPRERYQVTQHQQSQYGGGCSNGLDETFCAMRIWQNIDNPNLADTYNPRAGRVTNLNSQKFPILNLIQ- MSAVKVNLYQNALLSP FWNINSHSVVYVTQGCARVQVVNNNGKTVFNGELRRGQLLIIPQHYVVVKKAQREGCAYIAFKTNPNSMVSHIV- GKSSIFRALPTDVLANAY RISREDAQRLKHNRGDELGAFTPLQYKSYQDVSSVAASS [SEQ ID 251] Homologs of Rice protein 4 (SEQ ID 11) >gi|531874314|gb|AGT59174.1| glutelin, partial [Oryza sativa Indica Group] CRFDRLQAFEPIRSVRSQAGTTEFFDVSNEQFQCTGVSAVRRVIEPRGLLLPHYTNGASLVYIIQGRGITGPTF- PGCPESYQQQFQQSGQAQLT ESQSQSHKFKDEHQKIHRFRQGDVIALPAGVAHWCYNDGEVPVVAIYVTDLNNGANQLDPRQRDFLLAGNKRNP- QAYRREVEERSQNIFSG FSTELLSEALGVSSQVARQLQCQNDQRGEIVRVEHGLSLLQPYASLQEQEQGQVQSRERYQEGQYQQSQYGSGC- SNGLDETFCTMKVRQN1 DNPNRADTYNPRAGRVTNLNTQNFPILNLVQMSAVKVNLYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGK- TVFNGELRRGQLLIIPQ HYAVVKKAQREGCAYIAFKTNPNSMVSHIAGKSSIFRALPNDVLANAYRISREEAQRLKHNRGDEFGAFTPIQY- KSYQDVYNAAESS [SEQ ID 252] >gi|109894635|gb|ABG47337.1| glutelin precursor [Zizania latifolia] MNMATINGPTIFFTVCLFLLCHGSLAQLLGQSTSQWQSSHRGSSRQCRFDRLQAFEPVRSVRSQAGTTEFFDAS- NELFQCAGVSIVRRIIEPRG LLLPQYTNGATIMYIIQGRGITGQTFPGCPESYQQQFQQSMQAQLTGSQSQSQKFKDEHQKINRFRQGDVIALP- AGVAHWCYNDGEVPVVA IYVIDINNAANQLDPRQRDFLLAGNMRSPQAYRREVENQSQNIFSGFSAELLSEALGISTGVARQLQCQNDQRG- EIVRVEHGLSLLQPYASLQE QEQKQEQPRERYQVTQHQQSQYGGGCSNGLDETFCAMRIWQNIDNPNLADTYNPRAGRVTNLNSQKFPILNLIQ- MSAVKVNLYQNALLSP FWNINSHSVVYVTQGCARVQVVNNNGKTVFNGELRRGQLLIIPQHYVVVKKAQREGCAYIAFKTNPNSMVSHIV- GKSSIFRALPTDVLANAY RISREDAQRLKHNRGDELGAFTPLQYKSYQDVSSVAASS [SEQ ID 253] >gi|472867|emb|CAA52764.1| 11S globulin [Avena sativa] MATTSFPSMLFYFCIFLLFHGSMAQLFGQSSTPWQSSRQGGLRGCRFDRLQAFEPLRQVRSQAGITEYFDEQNE- QFRCTGVSVIRRVIEPQGL VLPQYHNAPALVYILQGRGFTGLTFPGCPATFQQQFQPFDQSQFAQGQRQSQTIKDEHQRVQRFKQGDVVALPA- GIVHWCYNDGDAPIVA IYVFDVNNNANQLEPRQKEFLLAGNNKREQQSGNNIFSGLSVQLLSEALGISQQAAQRIQSQNDQRGEIIRVSQ- GLQFLKPIVSQQVPGEQQV YQPIQTQEGQATQYQVGQSTQYQVGKSTPYQGGQSSQYQAGQSWDQSFNGLEENFCSLEARKNIENPQHADTYN- PRAGRITRLNSKNFPIL NIVQMSATRVNLYQNAILSPFWNINAHSVIYMIQGHARVQVVNNNGQTVFNDILRRGQLLIVPQHFVVLKKAER- EGCQYISFKTNPNSMVSH IAGKSSILRALPIDVLANAYRISRQEARNLKNNRGEEFGAFTPKLTQKGFQSYQDIEEGSSSPVRASE [SEQ ID 254] Homoiogs of Rice protein 5 (SEQ. ID 12) >gi|225959|prf|1404367A glutelin MASTNRPIVFFTVCLFLLCDGSLAQQLLGQSTSQWQSSRRGSPRGCRFDRLQAFEPIRSVRSQAGTTEFFDVSN- ELFQCTGVSVVRRVIEPRGL LLPHYTNGASLVYIIQGRGITGPTFPGCPETYQQQFQQSGQAGLTESQSQSHKFKDEHQKIHRFRQGDVIALPA- GVAHWCYNDCEVPVVAIYV TDINNGANQLDPRQRDFLLAGNKRNPQAYRREVEEWSQNIFSGFSTELLSEAFGISNQVARQLQCQNDQKGEIV- RVERGLSLLQPYASLQEQ EQGQMQSREHYQEGGYQQSQYGSGCPNGLDETFCVNKVRQNIDNPNRADTYNPRAGRVTNLSQNFPILNLVQMS- AVKVNLYQNTDTWIS MGQEENALLSPFWNINAHSIVYITQGRAQVQVLRRGQLLIVPQHYVVVKKAQREGCAYIAFKTNPNSMVSHIAG- KSSIFRALPTDVLANAYRIS REEAQRLKHNRGDEFGAFTPLQYKSYQDVYNVAESS [SEQ ID 255] >gi|573943558|ref|XP_006654150.1| PREDICTED: glutelin type-A 3-like [Oryza brachyantha] MKSSIVFSTICLVLLCHGSLAQLLSQSTSQWQSSRRGSPRQCRFDQLQAFEPIRWRSQAGVTEFYDVSNELFQC- TGVSVVRRVIEPRGLLLPHY SNGATLVYIIQGRGITGPTFPGCPETYQQQFQQSGEAQPFEGQSHKFRDEHQKIHRFRQGDVVALPAGVAHWCY- NDGEVPIVAIYVTDIYNS ANQLDPRHRDFFLAGNNKVAQQLYRSEARENSKNIFGGFSVELLSEALGISRGVARQLQCQNDQRGEIVRVEHG- LALLQPYASVQEQQQEQV QSRDYEQTQYQQKQPQGSCSNGLDETFCTMRLRQNIDNPNLADTYNPKAGRITYLNGQKFPILNLVQMSAVKVN- LYQNAVLSPFWNINAHS VVYITQGRARVQVVNNNGKTVFDGELRQGQLLIIPQHHVVLKKAQREGCSYIALKTNPNSIVSHIAGKNSIFRA- LPGDVVTNAYRISREEAKRIK HNRGDESGVFAPSHAYRSYQDMSVAA [SEQ ID 256] >gi|721641733|ref|XP_010231907.1| PREDICTED: 12S seed storage globulin 1-like [Brachypodium distachyon] MAHTSFSSFLSYFCLFLLFHGSMAQVLGQVSTWQSSRQGGSRDCSFDRLQAIEPVTQVRSQAGLTEYFDEQNEQ- FRCAGVFVIRRVIEPRGLL LPRYHNTPGLVYILQGNGFVGLTFPGCPETFREQFQQFRQTQSTLGQSQCQSQKLGDVHQRVHQFTQGDVVALP- TGVAHWIYNGGDAPVV IVYVFDVNNNANQLEPRQKEFLLGGNYNGVLQYGQNIFSGFNAQLLSQAFGINEQTSQRIQNQNDGRGDIIRVD- NGLQFLKPVVTQQQPEQ PFMPIQHQTGQSSRNGLEENFCSLEPRQNIEDPNRADTYNPRAGSITRLNGQNFPILNLVQMSATRVNLQKNAI- LSPFWNINAHSVVYVIQG HALVQVVNNQGHNVFNGLLHRGQLLIIPQNYVVLKKAESEGYQYIAFKTNANSMVSHIAGKNSILRALPVDVIA- NAYRISRQEAQNLKNNRGE ETGVLTPNFSQSTCQSYQTEDVQSLRPMSHWSE [SEQ ID 257] Homologs of Rice protein 6 (SEQ ID 13) >gi|169244463|gb|ACA50505.1| seed allergenic protein RAG2 [Oryza sativa Japonica Group] MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVD- EQLRQDCCRQLAAVD DSWCRCSALNHMVGGIYRELGATDVGHPMAXVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPR- TGH [SEQ ID 258] >gi|5777592|emb|CAA44001.1| low molecular weight globulin [Oryza sativa] MASNKVVFSALLLIIVSVLRRDGTMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGAVDE- QLRQDCCRQLAAVDD SWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRT- GH [SEQ ID 259] >gi|115471175|ref|NP_001059186.1| Os07g0214600 [Oryza sativa Japonica Group] >gi|23616954|db|BAC20657.1|allergen RA16 [Oryza sativa Japonica Group] >gi|113610722|dbj|BAF21100.1| Os07g0214600 [Oryza sativa JaponicaGroup] >gi|125557687|gb|EAZ03223.1| hypothetical protein Osl_25372 [Oryza sativa Indica Group] MASNKVVISALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVKRQCVAPGTVDEQVR- RGCCRQLAAIDSSWCRC DALNHMLRI1YRESGAADAGHPMAEVFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWLPGTGY [SEQ ID 260] Homologs of Rice protein 7 (SEQ ID 14) >gi|115445309|ref|NP_001046434.1| Os2g0248800 [Oryza sativa Japonica Group] >gi|37993738|gb|AAR06952.1| glutelin type-B [Oryza sativa Japonica Group] >gi|47497729|dbj|BAD19794.1| glutelin type-B [Oryza sativa Japonica Group] >gi|113535965|dbj|BAF08348.1| Os02g0248800 [Oryza sativa Japonica Group] >gi|215768942|dbj|BAH01171.1| unnamed protein product [Oryza sativa Japonica Group] >gi|2844317721gbIADB84627.11 glutelin [Oryza sativa Japonica Group] MTISVFSRFSIYFCVLLLCNGSMAQLFDPATNQWQTHRQGSFRECRFERLQAFEPLQNVRSEAGVTEYFDETNE- LFQCTGTFVIRRVIQPQGLL IPRYANTPGMVYIIQGRGSMGLTFPGCPATYQQQSQQFLFQGESQSQKFIDEHQKIHQFRQGDIVVLPTGVAHW- FYNDGDTPVVALYVYDI NNSANQLEPRHREFLLAGKNNRVQQVYGRSIQQHSGQNIFNGFSVEPLSEALNINTVTTKRLQSQNDQRGEIIH- VKNGLQLLKPTLTQRQEQE QAQYQEVQYSEKPQTSSRWNGLEENLCTIKTRLNIENPSRADSYDPRAGRITSLDSQKFPILNIIQMSATRVNL- YQNAILTPFWNVNAHSLMYV IRGRARVQVVSNFGKTVFDGVLRPEQLLIIPQNYVVLKKAQHEGCQYIAINTNANAFVSHLAGVDSVFHALPVD- VIANAYCISREEARRLKNNR GDEYGPFPPRLQQQIYPEFSNESKGETSE [SEQ ID 261] >gi|428674402|gb|AFZ41188.1| glutelin, partial [Oryza sativa Japonica Group] LLCHGSMAQIFSLGINPWQNPRQGGSRECRFDRLQAFEPLRKVRHEAGVTEYFDEKNEQFQCTGTLVIRRIIEP- QGLLLPRYSNTPGLVYIIQGT GVLGLTFPGCPATYQKQFRHFGLEGGSQRQGKKLRDENQKIHQFRQGDVVALPSGIPHWFYNEGDTPVVALFVF- DVNNNANQLEPRQKEFL LAGNNIEQQVSNPSINKHSGQNIFNGFNTKLLSEALGVNIEVTRRLQSQNDRRGDIIRVKNGLRLIKPTITQQQ- EQTQDQYQQIQYHIREQRSTS KYNGLDENFCAIRARLNIENPNHADTYNPRAGRITNLNSQKFSILNLVQMSATRVNLYQNAILSPFWNINAHSL- VYTIQGRARVQVVSNHGKA VFNGVLRPGQLLIIPQNYVVMKKAELEGFQFIAFKTNPNAMVNHIAGKNSVLRAMPVDVIANAYRISRQEARSL- KNNRGEEIGAFTPRYQQQ KIHQEYSNPNESETQ [SEQ ID 262] >gi|226510|prf|1515394A seed storage globulin MATTRFPSLLFYSCIFLLCNGSMAQLFGQSFTPWQSSRQGGLRGCRFDRLQAFEPLRQVRSQAGITEYFDEQNE- QFRCAGVSVIRRVIEPQGLL LPQYHNAPGLVYILQGRGFTGLTFPGCPATFQQQFQPFDQARFAQGQSKSQNLKDEHQRVHHIKQGDVVALPAG- IVHWCYNDGDAPIVAV YVFDVNNNANQLEPRQKEFLLAGNNKREQQFGQNIFSGFSVQLLSEALGISQQAAQKIQSQNDQRGEIIRVSQG- LQFLKPFVSQQGPVEHQA YQPIQSQQEQSTQYQVGQSPQYQEGQSTQYQSGQSWDQSFNGLEENFCSLEARQNIENPKRADTYNPRAGRITH- LNSKNFPTLNLVQMSA TRVNLYQNAILSPYWNINAHSVMHMIQGRARVQVVNNHGQTVFNDILRRGQLLIIPQHYVVLKKAEREGCQYIS- FKTTPNSMVSYIAGKTSIL RALPVDVLANAYRISRQESQNLKNNRGEEFGAFTPKFAQTGSQSYQDEGESSSTEKASE [SEQ ID 263] Homologs of Rice protein 8 (SEQ ID 15) >gi|83375868|gb|ABC17777.1| waxy [Oryza rufipogon] MSALTTSQLATSATGFGIADRSAPSSLLRHGFQGLKPRSPAGGDATSLSVTTSARATPKQQRSVQRGSRRFPSV- VVYATGAGMNVVFVGAEM APWSKTGGLGDVLGGLPPAMAANGHRVMVISPRYDQYKDAWDTSVVAEIKVADRYERVRFFHCYKRGVDRVFVD- HPSFLEKVWGKTGEKI YGPDTGVDYKDNQMRFSLLCQAPRILNLNNNPYFKGTYGEDVVFVCNDWHTGPLASYLKNNYQPNGIYRNAKVA- FCIHNISYQGRFAFEDYP ELNLSERFRSSFDFIDGYDTPVEGRKINWMKAGILEADRVLTVSPYYAEELISGIARGCELDNIMRLTGITGIV- NGMDVSEWDPSKDKYITAKYD ATTAIEAKALNKEALQAEAGLPVDRKIPLIAFIGRLEEQKGPDVMAAAIPELMQEDVQIVLLGTGKKKFEKLLK- SMEEKYPGKVRAVVKFNAPLA HLIMAGADVLAVPSRFEPCGLIQLQGMRYGTPCACASTGGLVDTVIEGKTGFHMGRLSVDCKVVEPSDVKKVAA- TLKRAIKVVGTPAYEEMV RNCMNQDLSWKGPAKNWENVLLGLGVAGSAPGIEGDEIAPLAKENVAAP [SEQ ID 264] >gi|297614332|gb|ADI48504.1| glycogen synthetase [Oryza officinalis] MSALTTSQLATSATGFGIADRSAPSSLLRHGFQGLKPRSPAGGDASSLSVTTSARATPKQQRSVQRGSRRFPSV- VVYATGAGMNVVFVGAEM APWSKTGGLGDVLGGLPPAMAANGHRVMVISPRHDQYKDAWDTSVVAEIKVADRYERVRFFHCYKRGVDRVFID- HPSFLEKVWGKTGEKI YGPDTGVDYKDNQMRFSLLCQAALEAPRILNLNNNPYFKGTYGEDVVFVCNDWHTGPLPSYLKNNYQPNGIYRN- AKVAFCIHNISYQGRFAF EDYPELNLSERFRSSFDFIDGYDTPVEGRKINWMKAGILESDRVLTVSPYYAEELISGIARGCELDNIMRLTGI- TGIVNGMDVSEWDPSKDKYIA AKYDATTAIEAKALNKEALQAEAGLPVDRKIPLIAFIGRLEEQKGPDVMAAAIPELMQENVQIVLLGTGKKKFE- KLLKSMEEKYPGKVRAVVKF NAPLAHLIMAGADVLAVPSRFEPCGLIQLQGMRYGTPCACASTGGLVDTVIEGKTGFHMGRLSVDCKVVEPSDV- QKVATTLKRAIKIVGTPAY NEMVRNCMNQDLSWKGPAKNWENVLLGLGVAGSAPGVEGEEIAPLAKENVAAP [SEQ ID 265] >gi|389620054|gb|AFK93486.1| granule-bound starch synthase [Hordeum vulgare subsp. vulgare] MAALATSQLATSGTVLGVTDRFRRPGFQGLRPRNPADAALGMRTIGASAAPKQSRKAHRGSRRCLSVVVRATGS- GMNLVFVGAEMAPWS KTGGLGDVLGGLPPAMAANGHRVMVVSPRYDQYKDAWDTSVISEIKVADEYERVRFFHCYKRGVDRVFIDHPWF- LEKVRGKTKEKIYGPDA GTDYEDNQQRFSLLCQAALEAPRILNLNNNPYFSGPYGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAF- CIHNISYQGRFSFDDFAQL NLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVSPYYAEELISDEARGCELDNIMRLTGITGIVNG- MDVSEWDPTKDKFLAVNYDI TTALEAKALNKEALQAEVGLPVDRKVPLVAFIGRLEEQKGPDVMIAAIPEILKEEDVQIILLGTGKKKFEKLLK- SMEEKFPGKVRAVVRFNAPLAH QMMAGADLLAVTSRFEPCGLIQLQGMRYGTPCVCASTGGLVDTIVEGKTGFHMGRLSVDCNVVEPADVKKVATT- LKRAVKVVGTPAYQEM VKNCMIQDLSWKGPAKNWEDVLLELGVEGSEPGIVGEEIAPLAMENVAAP [SEQ ID 266] Homologs of GLUC (Staphylococcus aureus) protein 1 (SEQ ID 16) >gi|446599182|ref|WP_000676528.1| glutamyl endopeptidase [Staphylococcus aureus] >gi|253729369|gb|EES98098.1| trypsin [Staphylococcus aureus subsp. aureus TCH130] >gi|341844549|gb|EGS85761.1| glutamyl endopeptidase [Staphylococcus aureus subsp. aureus 21259] >gi|537390486|gb|AGU61109.1| Glutamyl endopeptidase precursor [Staphylococcus aureus subsp. aureus CN1] >gi|564714561|gb|ETD14665.1| glutamyl endopeptidase [Staphylococcus aureus subsp. aureus KPL1845] >gi|577466329|gb|EUG79766.1| glutamyl endopeptidase [Staphylococcus aureus M0139] >gi|580560623|gb|EVF84961.1| glutamyl endopeptidase [Staphylococcus aureus COAS6020] >gi|580687002|gb|EVH10169.1| glutamyl endopeptidase [Staphylococcus aureus UCIM6080]

>gi|751815683|gb|KIN24957.1| glutamyl endopeptidase [Staphylococcus aureus MRSA_CVM43477] >gi|781884797|dbj|BAR08486.1| glutamyl endopeptidase precursor [Staphylococcus aureus subsp. aureus] >gi|781887762|dbj|BAR11210.1| glutamyl endopeptidase precursor [Staphylococcus aureus subsp. aureus] MKGKFLKVSSLFVATLTTATLVSSPAANALSSKAMDNHPQQSQSSKQQTPKIQKGGNLKPLEQREHANVILPNN- DRHQITDTTNGHYAPVTYI QVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKF- SPNEQNKHIGEVVKPATMS NNAETQVNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEF- NGAVFINENVRNFLKQ NIEDIHFANDDQPNNPDNPDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA [SEQ ID 267]

SEQUENCE LISTINGS

1

SEQUENCE LISTING <160> NUMBER OF SEQ ID NOS: 425 <210> SEQ ID NO 1 <211> LENGTH: 459 <212> TYPE: PRT <213> ORGANISM: Pisum sativum <400> SEQUENCE: 1 Met Ala Ala Thr Thr Met Lys Ala Ser Phe Pro Leu Leu Met Leu Met 1 5 10 15 Gly Ile Ser Phe Leu Ala Ser Val Cys Val Ser Ser Arg Ser Asp Pro 20 25 30 Gln Asn Pro Phe Ile Phe Lys Ser Asn Lys Phe Gln Thr Leu Phe Glu 35 40 45 Asn Glu Asn Gly His Ile Arg Leu Leu Gln Lys Phe Asp Gln Arg Ser 50 55 60 Lys Ile Phe Glu Asn Leu Gln Asn Tyr Arg Leu Leu Glu Tyr Lys Ser 65 70 75 80 Lys Pro His Thr Ile Phe Leu Pro Gln His Thr Asp Ala Asp Tyr Ile 85 90 95 Leu Val Val Leu Ser Gly Lys Ala Ile Leu Thr Val Leu Lys Pro Asp 100 105 110 Asp Arg Asn Ser Phe Asn Leu Glu Arg Gly Asp Thr Ile Lys Leu Pro 115 120 125 Ala Gly Thr Ile Ala Tyr Leu Val Asn Arg Asp Asp Asn Glu Glu Leu 130 135 140 Arg Val Leu Asp Leu Ala Ile Pro Val Asn Arg Pro Gly Gln Leu Gln 145 150 155 160 Ser Phe Leu Leu Ser Gly Asn Gln Asn Gln Gln Asn Tyr Leu Ser Gly 165 170 175 Phe Ser Lys Asn Ile Leu Glu Ala Ser Phe Asn Thr Asp Tyr Glu Glu 180 185 190 Ile Glu Lys Val Leu Leu Glu Glu His Glu Lys Glu Thr Gln His Arg 195 200 205 Arg Ser Leu Lys Asp Lys Arg Gln Gln Ser Gln Glu Glu Asn Val Ile 210 215 220 Val Lys Leu Ser Arg Gly Gln Ile Glu Glu Leu Ser Lys Asn Ala Lys 225 230 235 240 Ser Thr Ser Lys Lys Ser Val Ser Ser Glu Ser Glu Pro Phe Asn Leu 245 250 255 Arg Ser Arg Gly Pro Ile Tyr Ser Asn Glu Phe Gly Lys Phe Phe Glu 260 265 270 Ile Thr Pro Glu Lys Asn Pro Gln Leu Gln Asp Leu Asp Ile Phe Val 275 280 285 Asn Ser Val Glu Ile Lys Glu Gly Ser Leu Leu Leu Pro His Tyr Asn 290 295 300 Ser Arg Ala Ile Val Ile Val Thr Val Asn Glu Gly Lys Gly Asp Phe 305 310 315 320 Glu Leu Val Gly Gln Arg Asn Glu Asn Gln Gln Glu Gln Arg Lys Glu 325 330 335 Asp Asp Glu Glu Glu Glu Gln Gly Glu Glu Glu Ile Asn Lys Gln Val 340 345 350 Gln Asn Tyr Lys Ala Lys Leu Ser Ser Gly Asp Val Phe Val Ile Pro 355 360 365 Ala Gly His Pro Val Ala Val Lys Ala Ser Ser Asn Leu Asp Leu Leu 370 375 380 Gly Phe Gly Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly 385 390 395 400 Asp Glu Asp Asn Val Ile Ser Gln Ile Gln Arg Pro Val Lys Glu Leu 405 410 415 Ala Phe Pro Gly Ser Ala Gln Glu Val Asp Arg Ile Leu Glu Asn Gln 420 425 430 Lys Gln Ser His Phe Ala Asp Ala Gln Pro Gln Gln Arg Glu Arg Gly 435 440 445 Ser Arg Glu Thr Arg Asp Arg Leu Ser Ser Val 450 455 <210> SEQ ID NO 2 <211> LENGTH: 124 <212> TYPE: PRT <213> ORGANISM: Pisum sativum <400> SEQUENCE: 2 Asp Arg Arg Gln Glu Leu Ser Asn Glu Asn Val Leu Val Lys Val Ser 1 5 10 15 Arg Arg Gln Leu Glu Glu Leu Ser Lys Asn Ala Lys Ser Ser Ser Arg 20 25 30 Arg Ser Val Ser Ser Glu Ser Gly Pro Phe Asn Leu Arg Ser Glu Asp 35 40 45 Pro Leu Tyr Ser Asn Asn Ser Gly Lys Phe Phe Glu Leu Thr Pro Glu 50 55 60 Lys Asn Gln Gln Leu Gln Asp Leu Asp Leu Phe Val Asn Ser Val Asp 65 70 75 80 Leu Lys Glu Gly Ser Leu Leu Leu Pro Asn Tyr Asn Ser Arg Ala Leu 85 90 95 Leu Val Leu Val Leu Val Val Asn Glu Gly Lys Gly Asp Phe Glu Leu 100 105 110 Val Gly Gln Arg Asn Glu Asn Gln Gly Lys Glu Asn 115 120 <210> SEQ ID NO 3 <211> LENGTH: 520 <212> TYPE: PRT <213> ORGANISM: Pisum sativum <400> SEQUENCE: 3 Met Ala Thr Lys Leu Leu Ala Leu Ser Leu Ser Phe Cys Phe Leu Leu 1 5 10 15 Leu Gly Gly Cys Phe Ala Leu Arg Glu Gln Pro Glu Gln Asn Glu Cys 20 25 30 Gln Leu Glu Arg Leu Asn Ala Leu Glu Pro Asp Asn Arg Ile Glu Ser 35 40 45 Glu Gly Gly Leu Ile Glu Thr Trp Asn Pro Asn Asn Lys Gln Phe Arg 50 55 60 Cys Ala Gly Val Ala Leu Ser Arg Ala Thr Leu Gln His Asn Ala Leu 65 70 75 80 Arg Arg Pro Tyr Tyr Ser Asn Ala Pro Gln Glu Ile Phe Ile Gln Gln 85 90 95 Gly Asn Gly Tyr Phe Gly Met Val Phe Pro Gly Cys Pro Glu Thr Phe 100 105 110 Glu Glu Pro Gln Glu Ser Glu Gln Gly Glu Gly Arg Arg Tyr Arg Asp 115 120 125 Arg His Gln Lys Val Asn Arg Phe Arg Glu Gly Asp Ile Ile Ala Val 130 135 140 Pro Thr Gly Ile Val Phe Trp Met Tyr Asn Asp Gln Asp Thr Pro Val 145 150 155 160 Ile Ala Val Ser Leu Thr Asp Ile Arg Ser Ser Asn Asn Gln Leu Asp 165 170 175 Gln Met Pro Arg Arg Phe Tyr Leu Ala Gly Asn His Glu Gln Glu Phe 180 185 190 Leu Arg Tyr Gln His Gln Gln Gly Gly Lys Gln Glu Gln Glu Asn Glu 195 200 205 Gly Asn Asn Ile Phe Ser Gly Phe Lys Arg Asp Phe Leu Glu Asp Ala 210 215 220 Phe Asn Val Asn Arg His Ile Val Asp Arg Leu Gln Gly Arg Asn Glu 225 230 235 240 Asp Glu Glu Lys Gly Ala Ile Val Lys Val Lys Gly Gly Leu Ser Ile 245 250 255 Ile Ser Pro Pro Glu Lys Gln Ala Arg His Gln Arg Gly Ser Arg Gln 260 265 270 Glu Glu Asp Glu Asp Glu Asp Glu Glu Arg Gln Pro Arg His Gln Arg 275 280 285 Gly Ser Arg Gln Glu Glu Glu Glu Asp Glu Asp Glu Glu Arg Gln Pro 290 295 300 Arg His Gln Arg Arg Arg Gly Glu Glu Glu Glu Glu Asp Lys Lys Glu 305 310 315 320 Arg Arg Gly Ser Gln Lys Gly Lys Ser Arg Arg Gln Gly Asp Asn Gly 325 330 335 Leu Glu Glu Thr Val Cys Thr Ala Lys Leu Arg Leu Asn Ile Gly Pro 340 345 350 Ser Ser Ser Pro Asp Ile Tyr Asn Pro Glu Ala Gly Arg Ile Lys Thr 355 360 365 Val Thr Ser Leu Asp Leu Pro Val Leu Arg Trp Leu Lys Leu Ser Ala 370 375 380 Glu His Gly Ser Leu His Lys Asn Ala Met Phe Val Pro His Tyr Asn 385 390 395 400 Leu Asn Ala Asn Ser Ile Ile Tyr Ala Leu Lys Gly Arg Ala Arg Leu 405 410 415 Gln Val Val Asn Cys Asn Gly Asn Thr Val Phe Asp Gly Glu Leu Glu 420 425 430 Ala Gly Arg Ala Leu Thr Val Pro Gln Asn Tyr Ala Val Ala Ala Lys 435 440 445 Ser Leu Ser Asp Arg Phe Ser Tyr Val Ala Phe Lys Thr Asn Asp Arg 450 455 460 Ala Gly Ile Ala Arg Leu Ala Gly Thr Ser Ser Val Ile Asn Asn Leu 465 470 475 480 Pro Leu Asp Val Val Ala Ala Thr Phe Asn Leu Gln Arg Asn Glu Ala 485 490 495 Arg Gln Leu Lys Ser Asn Asn Pro Phe Lys Phe Leu Val Pro Ala Arg 500 505 510 Gln Ser Glu Asn Arg Ala Ser Ala 515 520 <210> SEQ ID NO 4 <211> LENGTH: 613 <212> TYPE: PRT <213> ORGANISM: Pisum sativum <400> SEQUENCE: 4 Met Ala Thr Thr Ile Lys Ser Arg Phe Pro Leu Leu Leu Leu Leu Gly 1 5 10 15

Ile Ile Phe Leu Ala Ser Val Val Cys Val Thr Tyr Ala Asn Tyr Asp 20 25 30 Glu Gly Ser Glu Pro Arg Val Pro Ala Gln Arg Glu Arg Gly Arg Gln 35 40 45 Glu Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser Tyr 50 55 60 Glu Lys Glu Glu Asp Glu Glu Glu Gly Gln Arg Glu Arg Gly Arg Gln 65 70 75 80 Glu Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser Tyr 85 90 95 Glu Lys Gln Glu Asp Glu Glu Glu Lys Gln Lys Tyr Arg Tyr Gln Arg 100 105 110 Glu Lys Glu Asp Glu Glu Glu Lys Gln Lys Tyr Gln Tyr Gln Arg Glu 115 120 125 Lys Lys Glu Gln Lys Glu Val Gln Pro Gly Arg Glu Arg Trp Glu Arg 130 135 140 Glu Glu Asp Glu Glu Gln Val Asp Glu Glu Trp Arg Gly Ser Gln Arg 145 150 155 160 Arg Glu Asp Pro Glu Glu Arg Ala Arg Leu Arg His Arg Glu Glu Arg 165 170 175 Thr Lys Arg Asp Arg Arg His Gln Arg Glu Gly Glu Glu Glu Glu Arg 180 185 190 Ser Ser Glu Ser Gln Glu Arg Arg Asn Pro Phe Leu Phe Lys Ser Asn 195 200 205 Lys Phe Leu Thr Leu Phe Glu Asn Glu Asn Gly His Ile Arg Leu Leu 210 215 220 Gln Arg Phe Asp Lys Arg Ser Asp Leu Phe Glu Asn Leu Gln Asn Tyr 225 230 235 240 Arg Leu Val Glu Tyr Arg Ala Lys Pro His Thr Ile Phe Leu Pro Gln 245 250 255 His Ile Asp Ala Asp Leu Ile Leu Val Val Leu Ser Gly Lys Ala Ile 260 265 270 Leu Thr Val Leu Ser Pro Asn Asp Arg Asn Ser Tyr Asn Leu Glu Arg 275 280 285 Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr Thr Ser Tyr Leu Val Asn 290 295 300 Gln Asp Asp Glu Glu Asp Leu Arg Leu Val Asp Leu Val Ile Pro Val 305 310 315 320 Asn Gly Pro Gly Lys Phe Glu Ala Phe Asp Leu Ala Lys Asn Lys Asn 325 330 335 Gln Tyr Leu Arg Gly Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asn 340 345 350 Thr Arg Tyr Glu Thr Ile Glu Lys Val Leu Leu Glu Glu Gln Glu Lys 355 360 365 Asp Arg Lys Arg Arg Gln Gln Gly Glu Glu Thr Asp Ala Ile Val Lys 370 375 380 Val Ser Arg Glu Gln Ile Glu Glu Leu Lys Lys Leu Ala Lys Ser Ser 385 390 395 400 Ser Lys Lys Ser Leu Pro Ser Glu Phe Glu Pro Ile Asn Leu Arg Ser 405 410 415 His Lys Pro Glu Tyr Ser Asn Lys Phe Gly Lys Leu Phe Glu Ile Thr 420 425 430 Pro Glu Lys Lys Tyr Pro Gln Leu Gln Asp Leu Asp Leu Phe Val Ser 435 440 445 Cys Val Glu Ile Asn Glu Gly Ala Leu Met Leu Pro His Tyr Asn Ser 450 455 460 Arg Ala Ile Val Val Leu Leu Val Asn Glu Gly Lys Gly Asn Leu Glu 465 470 475 480 Leu Leu Gly Leu Lys Asn Glu Gln Gln Glu Arg Glu Asp Arg Lys Glu 485 490 495 Arg Asn Asn Glu Val Gln Arg Tyr Glu Ala Arg Leu Ser Pro Gly Asp 500 505 510 Val Val Ile Ile Pro Ala Gly His Pro Val Ala Ile Thr Ala Ser Ser 515 520 525 Asn Leu Asn Leu Leu Gly Phe Gly Ile Asn Ala Glu Asn Asn Glu Arg 530 535 540 Asn Phe Leu Ser Gly Ser Asp Asp Asn Val Ile Ser Gln Ile Glu Asn 545 550 555 560 Pro Val Lys Glu Leu Thr Phe Pro Gly Ser Val Gln Glu Ile Asn Arg 565 570 575 Leu Ile Lys Asn Gln Lys Gln Ser His Phe Ala Asn Ala Glu Pro Glu 580 585 590 Gln Lys Glu Gln Gly Ser Gln Gly Lys Arg Ser Pro Leu Ser Ser Ile 595 600 605 Leu Gly Thr Phe Tyr 610 <210> SEQ ID NO 5 <211> LENGTH: 438 <212> TYPE: PRT <213> ORGANISM: Pisum sativum <400> SEQUENCE: 5 Met Ala Ala Thr Pro Ile Lys Pro Leu Met Leu Leu Ala Ile Ala Phe 1 5 10 15 Leu Ala Ser Val Cys Val Ser Ser Arg Ser Asp Gln Glu Asn Pro Phe 20 25 30 Ile Phe Lys Ser Asn Arg Phe Gln Thr Leu Tyr Glu Asn Glu Asn Gly 35 40 45 His Ile Arg Leu Leu Gln Lys Phe Asp Lys Arg Ser Lys Ile Phe Glu 50 55 60 Asn Leu Gln Asn Tyr Arg Leu Leu Glu Tyr Lys Ser Lys Pro Arg Thr 65 70 75 80 Leu Phe Leu Pro Gln Tyr Thr Asp Ala Asp Phe Ile Leu Val Val Leu 85 90 95 Ser Gly Lys Ala Thr Leu Thr Val Leu Lys Ser Asn Asp Arg Asn Ser 100 105 110 Phe Asn Leu Glu Arg Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr Ile 115 120 125 Ala Tyr Leu Ala Asn Arg Asp Asp Asn Glu Asp Leu Arg Val Leu Asp 130 135 140 Leu Thr Ile Pro Val Asn Lys Pro Gly Gln Leu Gln Ser Phe Leu Leu 145 150 155 160 Ser Gly Thr Gln Asn Gln Pro Ser Leu Leu Ser Gly Phe Ser Lys Asn 165 170 175 Ile Leu Glu Ala Ala Phe Asn Thr Asn Tyr Glu Glu Ile Glu Lys Val 180 185 190 Leu Leu Glu Gln Gln Glu Gln Glu Pro Gln His Arg Arg Ser Leu Lys 195 200 205 Asp Arg Arg Gln Glu Ile Asn Glu Glu Asn Val Ile Val Lys Val Ser 210 215 220 Arg Glu Gln Ile Glu Glu Leu Ser Lys Asn Ala Lys Ser Ser Ser Lys 225 230 235 240 Lys Ser Val Ser Ser Glu Ser Gly Pro Phe Asn Leu Arg Ser Arg Asn 245 250 255 Pro Ile Tyr Ser Asn Lys Phe Gly Lys Phe Phe Glu Ile Thr Pro Glu 260 265 270 Lys Asn Gln Gln Leu Gln Asp Leu Asp Ile Phe Val Asn Ser Val Asp 275 280 285 Ile Lys Glu Gly Ser Leu Leu Leu Pro Asn Tyr Asn Ser Arg Ala Ile 290 295 300 Val Ile Val Thr Val Thr Glu Gly Lys Gly Asp Phe Glu Leu Val Gly 305 310 315 320 Gln Arg Asn Glu Asn Gln Gly Lys Glu Asn Asp Lys Glu Glu Glu Gln 325 330 335 Glu Glu Glu Thr Ser Lys Gln Val Gln Leu Tyr Arg Ala Lys Leu Ser 340 345 350 Pro Gly Asp Val Phe Val Ile Pro Ala Gly His Pro Val Ala Ile Asn 355 360 365 Ala Ser Ser Asp Leu Asn Leu Ile Gly Phe Gly Ile Asn Ala Glu Asn 370 375 380 Asn Glu Arg Asn Phe Leu Ala Gly Glu Glu Asp Asn Val Ile Ser Gln 385 390 395 400 Val Glu Arg Pro Val Lys Glu Leu Ala Phe Pro Gly Ser Ser His Glu 405 410 415 Val Asp Arg Leu Leu Lys Asn Gln Lys Gln Ser Tyr Phe Ala Asn Ala 420 425 430 Gln Pro Leu Gln Arg Glu 435 <210> SEQ ID NO 6 <211> LENGTH: 484 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 6 Met Ala Thr Thr Thr Ser Leu Leu Ser Ser Cys Leu Cys Ala Leu Leu 1 5 10 15 Leu Ala Pro Leu Phe Ser Gln Gly Val Asp Ala Trp Glu Ser Arg Gln 20 25 30 Gly Ala Ser Arg Gln Cys Arg Phe Asp Arg Leu Gln Ala Phe Glu Pro 35 40 45 Leu Arg Lys Val Arg Ser Glu Ala Gly Asp Thr Glu Tyr Phe Asp Glu 50 55 60 Arg Asn Glu Gln Phe Arg Cys Ala Gly Val Phe Val Ile Arg Arg Val 65 70 75 80 Ile Glu Pro Gln Gly Leu Val Val Pro Arg Tyr Ser Asn Thr Pro Ala 85 90 95 Leu Ala Tyr Ile Ile Gln Gly Lys Gly Tyr Val Gly Leu Thr Phe Pro 100 105 110 Gly Cys Pro Ala Thr His Gln Gln Gln Phe Gln Leu Phe Glu Gln Arg 115 120 125 Gln Ser Asp Gln Ala His Lys Phe Arg Asp Glu His Gln Lys Ile His 130 135 140 Glu Phe Arg Gln Gly Asp Val Val Ala Leu Pro Ala Ser Val Ala His 145 150 155 160 Trp Phe Tyr Asn Gly Gly Asp Thr Pro Ala Val Val Val Tyr Val Tyr 165 170 175 Asp Ile Lys Ser Phe Ala Asn Gln Leu Glu Pro Arg Gln Lys Glu Phe 180 185 190 Leu Leu Ala Gly Asn Asn Gln Arg Gly Gln Gln Ile Phe Glu His Ser

195 200 205 Ile Phe Gln His Ser Gly Gln Asn Ile Phe Ser Gly Phe Asn Thr Glu 210 215 220 Val Leu Ser Glu Ala Leu Gly Ile Asn Thr Glu Ala Ser Lys Arg Leu 225 230 235 240 Gln Ser Gln Asn Asp Gln Arg Gly Asp Ile Ile Arg Val Lys His Gly 245 250 255 Leu Gln Leu Leu Lys Pro Thr Leu Thr Gln Arg Gln Glu Glu His Arg 260 265 270 Gln Tyr Gln Gln Val Gln Tyr Arg Glu Gly Gln Tyr Asn Gly Leu Asp 275 280 285 Glu Asn Phe Cys Thr Ile Lys Ala Arg Val Asn Ile Glu Asn Pro Ser 290 295 300 Arg Ala Asp Tyr Tyr Asn Pro Arg Ala Gly Arg Ile Thr Leu Leu Asn 305 310 315 320 Asn Gln Lys Phe Pro Ile Leu Asn Leu Ile Gly Met Gly Ala Ala Arg 325 330 335 Val Asn Leu Tyr Gln Asn Ala Leu Leu Ser Pro Phe Trp Asn Ile Asn 340 345 350 Ala His Ser Val Val Tyr Ile Ile Gln Gly Ser Val Arg Val Gln Val 355 360 365 Ala Asn Asn Gln Gly Arg Ser Val Phe Asn Gly Val Leu His Gln Gly 370 375 380 Gln Leu Leu Ile Ile Pro Gln Asn His Ala Val Ile Lys Lys Ala Glu 385 390 395 400 His Asn Gly Cys Gln Tyr Val Ala Ile Lys Thr Ile Ser Asp Pro Thr 405 410 415 Val Ser Trp Val Ala Gly Lys Asn Ser Ile Leu Arg Ala Leu Pro Val 420 425 430 Asp Val Ile Ala Asn Ala Tyr Arg Ile Ser Arg Asp Glu Ala Arg Arg 435 440 445 Leu Lys Asn Asn Arg Ala Asp Glu Ile Gly Pro Phe Thr Pro Arg Phe 450 455 460 Pro Gln Lys Ser Gln Arg Gly Tyr Gln Phe Leu Thr Glu Gly Leu Ser 465 470 475 480 Leu Ile Gly Met <210> SEQ ID NO 7 <211> LENGTH: 510 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 7 Met Ala Ser Met Ser Thr Ile Leu Pro Leu Cys Leu Gly Leu Leu Leu 1 5 10 15 Phe Phe Gln Val Ser Met Ala Gln Phe Ser Phe Gly Gly Ser Pro Leu 20 25 30 Gln Ser Pro Arg Gly Phe Arg Gly Asp Gln Asp Ser Arg His Gln Cys 35 40 45 Arg Phe Glu His Leu Thr Ala Leu Glu Ala Thr His Gln Gln Arg Ser 50 55 60 Glu Ala Gly Phe Thr Glu Tyr Tyr Asn Ile Glu Ala Arg Asn Glu Phe 65 70 75 80 Arg Cys Ala Gly Val Ser Val Arg Arg Leu Val Val Glu Ser Lys Gly 85 90 95 Leu Val Leu Pro Met Tyr Ala Asn Ala His Lys Leu Val Tyr Ile Val 100 105 110 Gln Gly Arg Gly Val Phe Gly Met Ala Leu Pro Gly Cys Pro Glu Thr 115 120 125 Phe Gln Ser Val Arg Ser Pro Phe Glu Gln Glu Val Ala Thr Ala Gly 130 135 140 Glu Ala Gln Ser Ser Ile Gln Lys Met Arg Asp Glu His Gln Gln Leu 145 150 155 160 His Gln Phe His Gln Gly Asp Val Ile Ala Val Pro Ala Gly Val Ala 165 170 175 His Trp Leu Tyr Asn Asn Gly Asp Ser Pro Val Val Ala Phe Thr Val 180 185 190 Ile Asp Thr Ser Asn Asn Ala Asn Gln Leu Asp Pro Lys Arg Arg Glu 195 200 205 Phe Phe Leu Ala Gly Lys Pro Arg Ser Ser Trp Gln Gln Gln Ser Tyr 210 215 220 Ser Tyr Gln Thr Glu Gln Leu Ser Arg Asn Gln Asn Ile Phe Ala Gly 225 230 235 240 Phe Ser Pro Asp Leu Leu Ser Glu Ala Leu Ser Val Ser Lys Gln Thr 245 250 255 Val Leu Arg Leu Gln Gly Leu Ser Asp Pro Arg Gly Ala Ile Ile Arg 260 265 270 Val Glu Asn Gly Leu Gln Ala Leu Gln Pro Ser Leu Gln Val Glu Pro 275 280 285 Val Lys Glu Glu Gln Thr Gln Ala Tyr Leu Pro Thr Lys Gln Leu Gln 290 295 300 Pro Thr Trp Leu Arg Ser Gly Gly Ala Cys Gly Gln Gln Asn Val Leu 305 310 315 320 Asp Glu Ile Met Cys Ala Phe Lys Leu Arg Lys Asn Ile Asp Asn Pro 325 330 335 Gln Ser Ser Asp Ile Phe Asn Pro His Gly Gly Arg Ile Thr Arg Ala 340 345 350 Asn Ser Gln Asn Phe Pro Ile Leu Asn Ile Ile Gln Met Ser Ala Thr 355 360 365 Arg Ile Val Leu Gln Asn Asn Ala Leu Leu Thr Pro His Trp Thr Val 370 375 380 Asn Ala His Thr Val Met Tyr Val Thr Ala Gly Gln Gly His Ile Gln 385 390 395 400 Val Val Asp His Arg Gly Arg Ser Val Phe Asp Gly Glu Leu His Gln 405 410 415 Gln Gln Ile Leu Leu Ile Pro Gln Asn Phe Ala Val Val Val Lys Ala 420 425 430 Arg Arg Glu Gly Phe Ala Trp Val Ser Phe Lys Thr Asn His Asn Ala 435 440 445 Val Asp Ser Gln Ile Ala Gly Lys Ala Ser Ile Leu Arg Ala Leu Pro 450 455 460 Val Asp Val Val Ala Asn Ala Tyr Arg Leu Ser Arg Glu Asp Ser Arg 465 470 475 480 His Val Lys Phe Asn Arg Gly Asp Glu Met Ala Val Phe Ala Pro Arg 485 490 495 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 500 505 510 <210> SEQ ID NO 8 <211> LENGTH: 386 <212> TYPE: PRT <213> ORGANISM: Pisum sativum <400> SEQUENCE: 8 Met Ala Thr Thr Ile Lys Ser Arg Phe Pro Leu Leu Leu Leu Leu Gly 1 5 10 15 Ile Ile Phe Leu Ala Ser Val Val Ser Val Thr Tyr Ala Asn Tyr Asp 20 25 30 Glu Gly Ser Glu Pro Arg Val Pro Ala Gln Arg Glu Arg Gly Arg Gln 35 40 45 Glu Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser Tyr 50 55 60 Glu Lys Glu Glu Asp Glu Glu Glu Gly Gln Arg Glu Arg Gly Arg Gln 65 70 75 80 Glu Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Gly Pro Ser Tyr 85 90 95 Glu Lys Gln Glu Asp Glu Glu Glu Lys Gln Lys Tyr Arg Tyr Gln Arg 100 105 110 Glu Lys Glu Asp Glu Glu Glu Lys Gln Lys Tyr Gln Tyr Gln Arg Glu 115 120 125 Lys Lys Glu Gln Lys Glu Val Gln Pro Gly Arg Glu Arg Trp Glu Arg 130 135 140 Glu Glu Asp Glu Glu Gln Val Asp Glu Glu Trp Arg Gly Ser Gln Arg 145 150 155 160 Arg Glu Asp Pro Glu Glu Arg Ala Arg Leu Arg His Arg Glu Glu Arg 165 170 175 Thr Lys Arg Asp Arg Arg His Gln Arg Glu Gly Glu Glu Glu Glu Arg 180 185 190 Ser Ser Glu Ser Gln Glu Arg Arg Asn Pro Phe Leu Phe Lys Ser Asn 195 200 205 Lys Phe Leu Thr Leu Phe Glu Asn Glu Asn Gly His Ile Arg Leu Leu 210 215 220 Gln Arg Phe Asp Lys Arg Ser Asp Leu Phe Glu Asn Leu Gln Asn Tyr 225 230 235 240 Arg Leu Val Glu Tyr Arg Ala Lys Pro His Thr Ile Phe Leu Pro Gln 245 250 255 His Ile Asp Ala Asp Leu Ile Leu Val Val Leu Ser Gly Lys Ala Ile 260 265 270 Leu Thr Val Leu Ser Pro Asn Asp Arg Asn Ser Tyr Asn Leu Glu Arg 275 280 285 Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr Thr Ser Tyr Leu Val Asn 290 295 300 Gln Asp Asp Glu Glu Asp Leu Arg Leu Val Asp Leu Val Ile Pro Val 305 310 315 320 Asn Gly Pro Gly Lys Phe Glu Ala Phe Asp Leu Ala Lys Asn Lys Asn 325 330 335 Gln Tyr Leu Arg Gly Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asn 340 345 350 Thr Arg Tyr Glu Thr Ile Glu Lys Val Leu Leu Glu Glu Gln Glu Lys 355 360 365 Asp Arg Lys Arg Arg Gln Gln Gly Glu Glu Thr Asp Ala Ile Val Lys 370 375 380 Val Ser 385 <210> SEQ ID NO 9 <211> LENGTH: 386 <212> TYPE: PRT <213> ORGANISM: Pisum sativum <400> SEQUENCE: 9 Met Ala Thr Thr Ile Lys Ser Arg Phe Pro Leu Leu Leu Leu Leu Gly

1 5 10 15 Ile Ile Phe Leu Ala Ser Val Val Ser Val Thr Tyr Ala Asn Tyr Asp 20 25 30 Glu Gly Ser Glu Pro Arg Val Pro Ala Gln Arg Glu Arg Gly Arg Gln 35 40 45 Glu Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser Tyr 50 55 60 Glu Lys Glu Glu Asp Glu Glu Glu Gly Gln Arg Glu Arg Gly Arg Gln 65 70 75 80 Glu Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Gly Pro Ser Tyr 85 90 95 Glu Lys Gln Glu Asp Glu Glu Glu Lys Gln Lys Tyr Arg Tyr Gln Arg 100 105 110 Glu Lys Glu Asp Glu Glu Glu Lys Gln Lys Tyr Gln Tyr Gln Arg Glu 115 120 125 Lys Lys Glu Gln Lys Glu Val Gln Pro Gly Arg Glu Arg Trp Glu Arg 130 135 140 Glu Glu Asp Glu Glu Gln Val Asp Glu Glu Trp Arg Gly Ser Gln Arg 145 150 155 160 Arg Glu Asp Pro Glu Glu Arg Ala Arg Leu Arg His Arg Glu Glu Arg 165 170 175 Thr Lys Arg Asp Arg Arg His Gln Arg Glu Gly Glu Glu Glu Glu Arg 180 185 190 Ser Ser Glu Ser Gln Glu Arg Arg Asn Pro Phe Leu Phe Lys Ser Asn 195 200 205 Lys Phe Leu Thr Leu Phe Glu Asn Glu Asn Gly His Ile Arg Leu Leu 210 215 220 Gln Arg Phe Asp Lys Arg Ser Asp Leu Phe Glu Asn Leu Gln Asn Tyr 225 230 235 240 Arg Leu Val Glu Tyr Arg Ala Lys Pro His Thr Ile Phe Leu Pro Gln 245 250 255 His Ile Asp Ala Asp Leu Ile Leu Val Val Leu Ser Gly Lys Ala Ile 260 265 270 Leu Thr Val Leu Ser Pro Asn Asp Arg Asn Ser Tyr Asn Leu Glu Arg 275 280 285 Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr Thr Ser Tyr Leu Val Asn 290 295 300 Gln Asp Asp Glu Glu Asp Leu Arg Leu Val Asp Leu Val Ile Pro Val 305 310 315 320 Asn Gly Pro Gly Lys Phe Glu Ala Phe Asp Leu Ala Lys Asn Lys Asn 325 330 335 Gln Tyr Leu Arg Gly Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asn 340 345 350 Thr Arg Tyr Glu Thr Ile Glu Lys Val Leu Leu Glu Glu Gln Glu Lys 355 360 365 Asp Arg Lys Arg Arg Gln Gln Gly Glu Glu Thr Asp Ala Ile Val Lys 370 375 380 Val Ser 385 <210> SEQ ID NO 10 <211> LENGTH: 499 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 10 Met Ala Ser Ser Val Phe Ser Arg Phe Ser Ile Tyr Phe Cys Val Leu 1 5 10 15 Leu Leu Cys His Gly Ser Met Ala Gln Leu Phe Asn Pro Ser Thr Asn 20 25 30 Pro Trp His Ser Pro Arg Gln Gly Ser Phe Arg Glu Cys Arg Phe Asp 35 40 45 Arg Leu Gln Ala Phe Glu Pro Leu Arg Lys Val Arg Ser Glu Ala Gly 50 55 60 Val Thr Glu Tyr Phe Asp Glu Lys Asn Glu Leu Phe Gln Cys Thr Gly 65 70 75 80 Thr Phe Val Ile Arg Arg Val Ile Gln Pro Gln Gly Leu Leu Val Pro 85 90 95 Arg Tyr Thr Asn Ile Pro Gly Val Val Tyr Ile Ile Gln Gly Arg Gly 100 105 110 Ser Met Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Tyr Gln Gln Gln 115 120 125 Phe Gln Gln Phe Ser Ser Gln Gly Gln Ser Gln Ser Gln Lys Phe Arg 130 135 140 Asp Glu His Gln Lys Ile His Gln Phe Arg Gln Gly Asp Ile Val Ala 145 150 155 160 Leu Pro Ala Gly Val Ala His Trp Phe Tyr Asn Asp Gly Asp Ala Pro 165 170 175 Ile Val Ala Val Tyr Val Tyr Asp Val Asn Asn Asn Ala Asn Gln Leu 180 185 190 Glu Pro Arg Gln Lys Glu Phe Leu Leu Ala Gly Asn Asn Asn Arg Ala 195 200 205 Gln Gln Gln Gln Val Tyr Gly Ser Ser Ile Glu Gln His Ser Gly Gln 210 215 220 Asn Ile Phe Ser Gly Phe Gly Val Glu Met Leu Ser Glu Ala Leu Gly 225 230 235 240 Ile Asn Ala Val Ala Ala Lys Arg Leu Gln Ser Gln Asn Asp Gln Arg 245 250 255 Gly Glu Ile Ile His Val Lys Asn Gly Leu Gln Leu Leu Lys Pro Thr 260 265 270 Leu Thr Gln Gln Gln Glu Gln Ala Gln Ala Gln Asp Gln Tyr Gln Gln 275 280 285 Val Gln Tyr Ser Glu Arg Gln Gln Thr Ser Ser Arg Trp Asn Gly Leu 290 295 300 Glu Glu Asn Phe Cys Thr Ile Lys Val Arg Val Asn Ile Glu Asn Pro 305 310 315 320 Ser Arg Ala Asp Ser Tyr Asn Pro Arg Ala Gly Arg Ile Thr Ser Val 325 330 335 Asn Ser Gln Lys Phe Pro Ile Leu Asn Leu Ile Gln Met Ser Ala Thr 340 345 350 Arg Val Asn Leu Tyr Gln Asn Ala Ile Leu Ser Pro Phe Trp Asn Val 355 360 365 Asn Ala His Ser Leu Val Tyr Met Ile Gln Gly Arg Ser Arg Val Gln 370 375 380 Val Val Ser Asn Phe Gly Lys Thr Val Phe Asp Gly Val Leu Arg Pro 385 390 395 400 Gly Gln Leu Leu Ile Ile Pro Gln His Tyr Ala Val Leu Lys Lys Ala 405 410 415 Glu Arg Glu Gly Cys Gln Tyr Ile Ala Ile Lys Thr Asn Ala Asn Ala 420 425 430 Phe Val Ser His Leu Ala Gly Lys Asn Ser Val Phe Arg Ala Leu Pro 435 440 445 Val Asp Val Val Ala Asn Ala Tyr Arg Ile Ser Arg Glu Gln Ala Arg 450 455 460 Ser Leu Lys Asn Asn Arg Gly Glu Glu His Gly Ala Phe Thr Pro Arg 465 470 475 480 Phe Gln Gln Gln Tyr Tyr Pro Gly Leu Ser Asn Glu Ser Glu Ser Glu 485 490 495 Thr Ser Glu <210> SEQ ID NO 11 <211> LENGTH: 499 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 11 Met Ala Ser Ile Asn Arg Pro Ile Val Phe Phe Thr Val Cys Leu Phe 1 5 10 15 Leu Leu Cys Asn Gly Ser Leu Ala Gln Gln Leu Leu Gly Gln Ser Thr 20 25 30 Ser Gln Trp Gln Ser Ser Arg Arg Gly Ser Pro Arg Glu Cys Arg Phe 35 40 45 Asp Arg Leu Gln Ala Phe Glu Pro Ile Arg Ser Val Arg Ser Gln Ala 50 55 60 Gly Thr Thr Glu Phe Phe Asp Val Ser Asn Glu Gln Phe Gln Cys Thr 65 70 75 80 Gly Val Ser Val Val Arg Arg Val Ile Glu Pro Arg Gly Leu Leu Leu 85 90 95 Pro His Tyr Thr Asn Gly Ala Ser Leu Val Tyr Ile Ile Gln Gly Arg 100 105 110 Gly Ile Thr Gly Pro Thr Phe Pro Gly Cys Pro Glu Ser Tyr Gln Gln 115 120 125 Gln Phe Gln Gln Ser Gly Gln Ala Gln Leu Thr Glu Ser Gln Ser Gln 130 135 140 Ser Gln Lys Phe Lys Asp Glu His Gln Lys Ile His Arg Phe Arg Gln 145 150 155 160 Gly Asp Val Ile Ala Leu Pro Ala Gly Val Ala His Trp Cys Tyr Asn 165 170 175 Asp Gly Glu Val Pro Val Val Ala Ile Tyr Val Thr Asp Leu Asn Asn 180 185 190 Gly Ala Asn Gln Leu Asp Pro Arg Gln Arg Asp Phe Leu Leu Ala Gly 195 200 205 Asn Lys Arg Asn Pro Gln Ala Tyr Arg Arg Glu Val Glu Glu Arg Ser 210 215 220 Gln Asn Ile Phe Ser Gly Phe Ser Thr Glu Leu Leu Ser Glu Ala Leu 225 230 235 240 Gly Val Ser Ser Gln Val Ala Arg Gln Leu Gln Cys Gln Asn Asp Gln 245 250 255 Arg Gly Glu Ile Val Arg Val Glu His Gly Leu Ser Leu Leu Gln Pro 260 265 270 Tyr Ala Ser Leu Gln Glu Gln Glu Gln Gly Gln Val Gln Ser Arg Glu 275 280 285 Arg Tyr Gln Glu Gly Gln Tyr Gln Gln Ser Gln Tyr Gly Ser Gly Cys 290 295 300 Ser Asn Gly Leu Asp Glu Thr Phe Cys Thr Leu Arg Val Arg Gln Asn 305 310 315 320 Ile Asp Asn Pro Asn Arg Ala Asp Thr Tyr Asn Pro Arg Ala Gly Arg 325 330 335 Val Thr Asn Leu Asn Thr Gln Asn Phe Pro Ile Leu Ser Leu Val Gln 340 345 350

Met Ser Ala Val Lys Val Asn Leu Tyr Gln Asn Ala Leu Leu Ser Pro 355 360 365 Phe Trp Asn Ile Asn Ala His Ser Val Val Tyr Ile Thr Gln Gly Arg 370 375 380 Ala Arg Val Gln Val Val Asn Asn Asn Gly Lys Thr Val Phe Asn Gly 385 390 395 400 Glu Leu Arg Arg Gly Gln Leu Leu Ile Ile Pro Gln His Tyr Ala Val 405 410 415 Val Lys Lys Ala Gln Arg Glu Gly Cys Ala Tyr Ile Ala Phe Lys Thr 420 425 430 Asn Pro Asn Ser Met Val Ser His Ile Ala Gly Lys Ser Ser Ile Phe 435 440 445 Arg Ala Leu Pro Asn Asp Val Leu Ala Asn Ala Tyr Arg Ile Ser Arg 450 455 460 Glu Glu Ala Gln Arg Leu Lys His Asn Arg Gly Asp Glu Phe Gly Ala 465 470 475 480 Phe Thr Pro Ile Gln Tyr Lys Ser Tyr Gln Asp Val Tyr Asn Ala Ala 485 490 495 Glu Ser Ser <210> SEQ ID NO 12 <211> LENGTH: 499 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 12 Met Ala Ser Ile Asn Arg Pro Ile Val Phe Phe Thr Val Cys Leu Phe 1 5 10 15 Leu Leu Cys Asp Gly Ser Leu Ala Gln Gln Leu Leu Gly Gln Ser Thr 20 25 30 Ser Gln Trp Gln Ser Ser Arg Arg Gly Ser Pro Arg Gly Cys Arg Phe 35 40 45 Asp Arg Leu Gln Ala Phe Glu Pro Ile Arg Ser Val Arg Ser Gln Ala 50 55 60 Gly Thr Thr Glu Phe Phe Asp Val Ser Asn Glu Leu Phe Gln Cys Thr 65 70 75 80 Gly Val Ser Val Val Arg Arg Val Ile Glu Pro Arg Gly Leu Leu Leu 85 90 95 Pro His Tyr Thr Asn Gly Ala Ser Leu Val Tyr Ile Ile Gln Gly Arg 100 105 110 Gly Ile Thr Gly Pro Thr Phe Pro Gly Cys Pro Glu Thr Tyr Gln Gln 115 120 125 Gln Phe Gln Gln Ser Gly Gln Ala Gln Leu Thr Glu Ser Gln Ser Gln 130 135 140 Ser His Lys Phe Lys Asp Glu His Gln Lys Ile His Arg Phe Arg Gln 145 150 155 160 Gly Asp Val Ile Ala Leu Pro Ala Gly Val Ala His Trp Cys Tyr Asn 165 170 175 Asp Gly Glu Val Pro Val Val Ala Ile Tyr Val Thr Asp Ile Asn Asn 180 185 190 Gly Ala Asn Gln Leu Asp Pro Arg Gln Arg Asp Phe Leu Leu Ala Gly 195 200 205 Asn Lys Arg Asn Pro Gln Ala Tyr Arg Arg Glu Val Glu Glu Trp Ser 210 215 220 Gln Asn Ile Phe Ser Gly Phe Ser Thr Glu Leu Leu Ser Glu Ala Phe 225 230 235 240 Gly Ile Ser Asn Gln Val Ala Arg Gln Leu Gln Cys Gln Asn Asp Gln 245 250 255 Arg Gly Glu Ile Val Arg Val Glu Arg Gly Leu Ser Leu Leu Gln Pro 260 265 270 Tyr Ala Ser Leu Gln Glu Gln Glu Gln Gly Gln Met Gln Ser Arg Glu 275 280 285 His Tyr Gln Glu Gly Gly Tyr Gln Gln Ser Gln Tyr Gly Ser Gly Cys 290 295 300 Pro Asn Gly Leu Asp Glu Thr Phe Cys Thr Met Arg Val Arg Gln Asn 305 310 315 320 Ile Asp Asn Pro Asn Arg Ala Asp Thr Tyr Asn Pro Arg Ala Gly Arg 325 330 335 Val Thr Asn Leu Asn Ser Gln Asn Phe Pro Ile Leu Asn Leu Val Gln 340 345 350 Met Ser Ala Val Lys Val Asn Leu Tyr Gln Asn Ala Leu Leu Ser Pro 355 360 365 Phe Trp Asn Ile Asn Ala His Ser Ile Val Tyr Ile Thr Gln Gly Arg 370 375 380 Ala Gln Val Gln Val Val Asn Asn Asn Gly Lys Thr Val Phe Asn Gly 385 390 395 400 Glu Leu Arg Arg Gly Gln Leu Leu Ile Val Pro Gln His Tyr Val Val 405 410 415 Val Lys Lys Ala Gln Arg Glu Gly Cys Ala Tyr Ile Ala Phe Lys Thr 420 425 430 Asn Pro Asn Ser Met Val Ser His Ile Ala Gly Lys Ser Ser Ile Phe 435 440 445 Arg Ala Leu Pro Thr Asp Val Leu Ala Asn Ala Tyr Arg Ile Ser Arg 450 455 460 Glu Glu Ala Gln Arg Leu Lys His Asn Arg Gly Asp Glu Phe Gly Ala 465 470 475 480 Phe Thr Pro Leu Gln Tyr Lys Ser Tyr Gln Asp Val Tyr Asn Val Ala 485 490 495 Glu Ser Ser <210> SEQ ID NO 13 <211> LENGTH: 160 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 13 Met Ala Ser Asn Lys Val Val Phe Ser Val Leu Leu Leu Ala Val Val 1 5 10 15 Ser Val Leu Ala Ala Thr Ala Thr Met Ala Glu Tyr His His Gln Asp 20 25 30 Gln Val Val Tyr Thr Pro Gly Pro Leu Cys Gln Pro Gly Met Gly Tyr 35 40 45 Pro Met Tyr Pro Leu Pro Arg Cys Arg Ala Leu Val Lys Arg Gln Cys 50 55 60 Val Gly Arg Gly Thr Ala Ala Ala Ala Glu Gln Val Arg Arg Asp Cys 65 70 75 80 Cys Arg Gln Leu Ala Ala Val Asp Asp Ser Trp Cys Arg Cys Glu Ala 85 90 95 Ile Ser His Met Leu Gly Gly Ile Tyr Arg Glu Leu Gly Ala Pro Asp 100 105 110 Val Gly His Pro Met Ser Glu Val Phe Arg Gly Cys Arg Arg Gly Asp 115 120 125 Leu Glu Arg Ala Ala Ala Ser Leu Pro Ala Phe Cys Asn Val Asp Ile 130 135 140 Pro Asn Gly Gly Gly Gly Val Cys Tyr Trp Leu Ala Arg Ser Gly Tyr 145 150 155 160 <210> SEQ ID NO 14 <211> LENGTH: 500 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 14 Met Ala Thr Ile Ala Phe Ser Arg Leu Ser Ile Tyr Phe Cys Val Leu 1 5 10 15 Leu Leu Cys His Gly Ser Met Ala Gln Leu Phe Gly Pro Asn Val Asn 20 25 30 Pro Trp His Asn Pro Arg Gln Gly Gly Phe Arg Glu Cys Arg Phe Asp 35 40 45 Arg Leu Gln Ala Phe Glu Pro Leu Arg Arg Val Arg Ser Glu Ala Gly 50 55 60 Val Thr Glu Tyr Phe Asp Glu Lys Asn Glu Gln Phe Gln Cys Thr Gly 65 70 75 80 Thr Phe Val Ile Arg Arg Val Ile Glu Pro Gln Gly Leu Leu Val Pro 85 90 95 Arg Tyr Ser Asn Thr Pro Gly Met Val Tyr Ile Ile Gln Gly Arg Gly 100 105 110 Ser Met Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Tyr Gln Gln Gln 115 120 125 Phe Gln Gln Phe Leu Pro Glu Gly Gln Ser Gln Ser Gln Lys Phe Arg 130 135 140 Asp Glu His Gln Lys Ile His Gln Phe Arg Gln Gly Asp Ile Val Ala 145 150 155 160 Leu Pro Ala Gly Val Ala His Trp Phe Tyr Asn Glu Gly Asp Ala Pro 165 170 175 Val Val Ala Leu Tyr Val Phe Asp Leu Asn Asn Asn Ala Asn Gln Leu 180 185 190 Glu Pro Arg Gln Lys Glu Phe Leu Leu Ala Gly Asn Asn Asn Arg Glu 195 200 205 Gln Gln Met Tyr Gly Arg Ser Ile Glu Gln His Ser Gly Gln Asn Ile 210 215 220 Phe Ser Gly Phe Asn Asn Glu Leu Leu Ser Glu Ala Leu Gly Val Asn 225 230 235 240 Ala Leu Val Ala Lys Arg Leu Gln Gly Gln Asn Asp Gln Arg Gly Glu 245 250 255 Ile Ile Arg Val Lys Asn Gly Leu Lys Leu Leu Arg Pro Ala Phe Ala 260 265 270 Gln Gln Gln Glu Gln Ala Gln Gln Gln Glu Gln Ala Gln Ala Gln Tyr 275 280 285 Gln Val Gln Tyr Ser Glu Glu Gln Gln Pro Ser Thr Arg Cys Asn Gly 290 295 300 Leu Asp Glu Asn Phe Cys Thr Ile Lys Ala Arg Leu Asn Ile Glu Asn 305 310 315 320 Pro Ser His Ala Asp Thr Tyr Asn Pro Arg Ala Gly Arg Ile Thr Arg 325 330 335 Leu Asn Ser Gln Lys Phe Pro Ile Leu Asn Leu Val Gln Leu Ser Ala 340 345 350 Thr Arg Val Asn Leu Tyr Gln Asn Ala Ile Leu Ser Pro Phe Trp Asn 355 360 365 Val Asn Ala His Ser Leu Val Tyr Ile Val Gln Gly His Ala Arg Val 370 375 380 Gln Val Val Ser Asn Leu Gly Lys Thr Val Phe Asn Gly Val Leu Arg

385 390 395 400 Pro Gly Gln Leu Leu Ile Ile Pro Gln His Tyr Val Val Leu Lys Lys 405 410 415 Ala Glu His Glu Gly Cys Gln Tyr Ile Ser Phe Lys Thr Asn Ala Asn 420 425 430 Ser Met Val Ser His Leu Ala Gly Lys Asn Ser Ile Phe Arg Ala Met 435 440 445 Pro Val Asp Val Ile Ala Asn Ala Tyr Arg Ile Ser Arg Glu Gln Ala 450 455 460 Arg Ser Leu Lys Asn Asn Arg Gly Glu Glu Leu Gly Ala Phe Thr Pro 465 470 475 480 Arg Tyr Gln Gln Gln Thr Tyr Pro Gly Phe Ser Asn Glu Ser Glu Asn 485 490 495 Glu Ala Leu Glu 500 <210> SEQ ID NO 15 <211> LENGTH: 609 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 15 Met Ser Ala Leu Thr Thr Ser Gln Leu Ala Thr Ser Ala Thr Gly Phe 1 5 10 15 Gly Ile Ala Asp Arg Ser Ala Pro Ser Ser Leu Leu Arg His Gly Phe 20 25 30 Gln Gly Leu Lys Pro Arg Ser Pro Ala Gly Gly Asp Ala Thr Ser Leu 35 40 45 Ser Val Thr Thr Ser Ala Arg Ala Thr Pro Lys Gln Gln Arg Ser Val 50 55 60 Gln Arg Gly Ser Arg Arg Phe Pro Ser Val Val Val Tyr Ala Thr Gly 65 70 75 80 Ala Gly Met Asn Val Val Phe Val Gly Ala Glu Met Ala Pro Trp Ser 85 90 95 Lys Thr Gly Gly Leu Gly Asp Val Leu Gly Gly Leu Pro Pro Ala Met 100 105 110 Ala Ala Asn Gly His Arg Val Met Val Ile Ser Pro Arg Tyr Asp Gln 115 120 125 Tyr Lys Asp Ala Trp Asp Thr Ser Val Val Ala Glu Ile Lys Val Ala 130 135 140 Asp Arg Tyr Glu Arg Val Arg Phe Phe His Cys Tyr Lys Arg Gly Val 145 150 155 160 Asp Arg Val Phe Ile Asp His Pro Ser Phe Leu Glu Lys Val Trp Gly 165 170 175 Lys Thr Gly Glu Lys Ile Tyr Gly Pro Asp Thr Gly Val Asp Tyr Lys 180 185 190 Asp Asn Gln Met Arg Phe Ser Leu Leu Cys Gln Ala Ala Leu Glu Ala 195 200 205 Pro Arg Ile Leu Asn Leu Asn Asn Asn Pro Tyr Phe Lys Gly Thr Tyr 210 215 220 Gly Glu Asp Val Val Phe Val Cys Asn Asp Trp His Thr Gly Pro Leu 225 230 235 240 Ala Ser Tyr Leu Lys Asn Asn Tyr Gln Pro Asn Gly Ile Tyr Arg Asn 245 250 255 Ala Lys Val Ala Phe Cys Ile His Asn Ile Ser Tyr Gln Gly Arg Phe 260 265 270 Ala Phe Glu Asp Tyr Pro Glu Leu Asn Leu Ser Glu Arg Phe Arg Ser 275 280 285 Ser Phe Asp Phe Ile Asp Gly Tyr Asp Thr Pro Val Glu Gly Arg Lys 290 295 300 Ile Asn Trp Met Lys Ala Gly Ile Leu Glu Ala Asp Arg Val Leu Thr 305 310 315 320 Val Ser Pro Tyr Tyr Ala Glu Glu Leu Ile Ser Gly Ile Ala Arg Gly 325 330 335 Cys Glu Leu Asp Asn Ile Met Arg Leu Thr Gly Ile Thr Gly Ile Val 340 345 350 Asn Gly Met Asp Val Ser Glu Trp Asp Pro Ser Lys Asp Lys Tyr Ile 355 360 365 Thr Ala Lys Tyr Asp Ala Thr Thr Ala Ile Glu Ala Lys Ala Leu Asn 370 375 380 Lys Glu Ala Leu Gln Ala Glu Ala Gly Leu Pro Val Asp Arg Lys Ile 385 390 395 400 Pro Leu Ile Ala Phe Ile Gly Arg Leu Glu Glu Gln Lys Gly Pro Asp 405 410 415 Val Met Ala Ala Ala Ile Pro Glu Leu Met Gln Glu Asp Val Gln Ile 420 425 430 Val Leu Leu Gly Thr Gly Lys Lys Lys Phe Glu Lys Leu Leu Lys Ser 435 440 445 Met Glu Glu Lys Tyr Pro Gly Lys Val Arg Ala Val Val Lys Phe Asn 450 455 460 Ala Pro Leu Ala His Leu Ile Met Ala Gly Ala Asp Val Leu Ala Val 465 470 475 480 Pro Ser Arg Phe Glu Pro Cys Gly Leu Ile Gln Leu Gln Gly Met Arg 485 490 495 Tyr Gly Thr Pro Cys Ala Cys Ala Ser Thr Gly Gly Leu Val Asp Thr 500 505 510 Val Ile Glu Gly Lys Thr Gly Phe His Met Gly Arg Leu Ser Val Asp 515 520 525 Cys Lys Val Val Glu Pro Ser Asp Val Lys Lys Val Ala Ala Thr Leu 530 535 540 Lys Arg Ala Ile Lys Val Val Gly Thr Pro Ala Tyr Glu Glu Met Val 545 550 555 560 Arg Asn Cys Met Asn Gln Asp Leu Ser Trp Lys Gly Pro Ala Lys Asn 565 570 575 Trp Glu Asn Val Leu Leu Gly Leu Gly Val Ala Gly Ser Ala Pro Gly 580 585 590 Ile Glu Gly Asp Glu Ile Ala Pro Leu Ala Lys Glu Asn Val Ala Ala 595 600 605 Pro <210> SEQ ID NO 16 <211> LENGTH: 336 <212> TYPE: PRT <213> ORGANISM: Staphylococcus aureus <400> SEQUENCE: 16 Met Lys Gly Lys Phe Leu Lys Val Ser Ser Leu Phe Val Ala Thr Leu 1 5 10 15 Thr Thr Ala Thr Leu Val Ser Ser Pro Ala Ala Asn Ala Leu Ser Ser 20 25 30 Lys Ala Met Asp Asn His Pro Gln Gln Thr Gln Ser Ser Lys Gln Gln 35 40 45 Thr Pro Lys Ile Gln Lys Gly Gly Asn Leu Lys Pro Leu Glu Gln Arg 50 55 60 Glu His Ala Asn Val Ile Leu Pro Asn Asn Asp Arg His Gln Ile Thr 65 70 75 80 Asp Thr Thr Asn Gly His Tyr Ala Pro Val Thr Tyr Ile Gln Val Glu 85 90 95 Ala Pro Thr Gly Thr Phe Ile Ala Ser Gly Val Val Val Gly Lys Asp 100 105 110 Thr Leu Leu Thr Asn Lys His Val Val Asp Ala Thr His Gly Asp Pro 115 120 125 His Ala Leu Lys Ala Phe Pro Ser Ala Ile Asn Gln Asp Asn Tyr Pro 130 135 140 Asn Gly Gly Phe Thr Ala Glu Gln Ile Thr Lys Tyr Ser Gly Glu Gly 145 150 155 160 Asp Leu Ala Ile Val Lys Phe Ser Pro Asn Glu Gln Asn Lys His Ile 165 170 175 Gly Glu Val Val Lys Pro Ala Thr Met Ser Asn Asn Ala Glu Thr Gln 180 185 190 Val Asn Gln Asn Ile Thr Val Thr Gly Tyr Pro Gly Asp Lys Pro Val 195 200 205 Ala Thr Met Trp Glu Ser Lys Gly Lys Ile Thr Tyr Leu Lys Gly Glu 210 215 220 Ala Met Gln Tyr Asp Leu Ser Thr Thr Gly Gly Asn Ser Gly Ser Pro 225 230 235 240 Val Phe Asn Glu Lys Asn Glu Val Ile Gly Ile His Trp Gly Gly Val 245 250 255 Pro Asn Glu Phe Asn Gly Ala Val Phe Ile Asn Glu Asn Val Arg Asn 260 265 270 Phe Leu Lys Gln Asn Ile Glu Asp Ile His Phe Ala Asn Asp Asp Gln 275 280 285 Pro Asn Asn Pro Asp Asn Pro Asp Asn Pro Asn Asn Pro Asp Asn Pro 290 295 300 Asn Asn Pro Asp Glu Pro Asn Asn Pro Asp Asn Pro Asn Asn Pro Asp 305 310 315 320 Asn Pro Asp Asn Gly Asp Asn Asn Asn Ser Asp Asn Pro Asp Ala Ala 325 330 335 <210> SEQ ID NO 17 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 17 Pro Phe Asn Leu Arg Ser Arg Gly Pro Ile Tyr Ser Asn Glu Phe Gly 1 5 10 15 Lys Phe Phe Glu Ile Thr 20 <210> SEQ ID NO 18 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 18 Lys Pro Asp Asp Arg Asn Ser Phe Asn Leu Glu Arg Gly Asp Thr Ile 1 5 10 15 Lys <210> SEQ ID NO 19

<211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 19 Tyr Leu Val Asn Arg Asp Asp Asn Glu Glu Leu Arg Val Leu Asp Leu 1 5 10 15 Ala Ile Pro Val Asn Arg Pro Gly Gln Leu Gln 20 25 <210> SEQ ID NO 20 <211> LENGTH: 51 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 20 Gln Glu Gln Arg Lys Glu Asp Asp Glu Glu Glu Glu Gln Gly Glu Glu 1 5 10 15 Glu Ile Asn Lys Gln Val Gln Asn Tyr Lys Ala Lys Leu Ser Ser Gly 20 25 30 Asp Val Phe Val Ile Pro Ala Gly His Pro Val Ala Val Lys Ala Ser 35 40 45 Ser Asn Leu 50 <210> SEQ ID NO 21 <211> LENGTH: 68 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 21 Ser Gly Phe Ser Lys Asn Ile Leu Glu Ala Ser Phe Asn Thr Asp Tyr 1 5 10 15 Glu Glu Ile Glu Lys Val Leu Leu Glu Glu His Glu Lys Glu Thr Gln 20 25 30 His Arg Arg Ser Leu Lys Asp Lys Arg Gln Gln Ser Gln Glu Glu Asn 35 40 45 Val Ile Val Lys Leu Ser Arg Gly Gln Ile Glu Glu Leu Ser Lys Asn 50 55 60 Ala Lys Ser Thr 65 <210> SEQ ID NO 22 <211> LENGTH: 74 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 22 Pro Phe Ile Phe Lys Ser Asn Lys Phe Gln Thr Leu Phe Glu Asn Glu 1 5 10 15 Asn Gly His Ile Arg Leu Leu Gln Lys Phe Asp Gln Arg Ser Lys Ile 20 25 30 Phe Glu Asn Leu Gln Asn Tyr Arg Leu Leu Glu Tyr Lys Ser Lys Pro 35 40 45 His Thr Ile Phe Leu Pro Gln His Thr Asp Ala Asp Tyr Ile Leu Val 50 55 60 Val Leu Ser Gly Lys Ala Ile Leu Thr Val 65 70 <210> SEQ ID NO 23 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 23 Gln Glu Val Asp Arg Ile Leu Glu Asn Gln Lys Gln Ser His Phe Ala 1 5 10 15 Asp Ala Gln Pro Gln Gln Arg Glu Arg Gly Ser Arg 20 25 <210> SEQ ID NO 24 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 24 Asn Asn Ser Gly Lys Phe Phe Glu Leu Thr Pro Glu Lys Asn Gln Gln 1 5 10 15 Leu Gln Asp Leu Asp Leu Phe Val Asn Ser Val Asp Leu Lys Glu Gly 20 25 30 Ser Leu Leu 35 <210> SEQ ID NO 25 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 25 Lys Val Ser Arg Arg Gln Leu Glu Glu Leu Ser Lys Asn Ala Lys Ser 1 5 10 15 Ser <210> SEQ ID NO 26 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 26 Gln Arg Gly Ser Arg Gln Glu Glu Asp Glu Asp Glu Asp Glu Glu Arg 1 5 10 15 Gln Pro Arg His Gln 20 <210> SEQ ID NO 27 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 27 Gln Glu Phe Leu Arg Tyr Gln His Gln Gln Gly Gly Lys Gln Glu Gln 1 5 10 15 Glu Asn Glu Gly Asn Asn Ile Phe Ser Gly Phe Lys Arg Asp Phe Leu 20 25 30 Glu <210> SEQ ID NO 28 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 28 Tyr Asn Leu Glu Arg Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr Thr 1 5 10 15 Ser Tyr Leu Val Asn Gln Asp Asp Glu Glu Asp Leu Arg Leu Val Asp 20 25 30 Leu Val <210> SEQ ID NO 29 <211> LENGTH: 80 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 29 Asn Gly Pro Gly Lys Phe Glu Ala Phe Asp Leu Ala Lys Asn Lys Asn 1 5 10 15 Gln Tyr Leu Arg Gly Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asn 20 25 30 Thr Arg Tyr Glu Thr Ile Glu Lys Val Leu Leu Glu Glu Gln Glu Lys 35 40 45 Asp Arg Lys Arg Arg Gln Gln Gly Glu Glu Thr Asp Ala Ile Val Lys 50 55 60 Val Ser Arg Glu Gln Ile Glu Glu Leu Lys Lys Leu Ala Lys Ser Ser 65 70 75 80 <210> SEQ ID NO 30 <211> LENGTH: 47 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 30 Arg Tyr Glu Ala Arg Leu Ser Pro Gly Asp Val Val Ile Ile Pro Ala 1 5 10 15 Gly His Pro Val Ala Ile Thr Ala Ser Ser Asn Leu Asn Leu Leu Gly 20 25 30 Phe Gly Ile Asn Ala Glu Asn Asn Glu Arg Asn Phe Leu Ser Gly 35 40 45 <210> SEQ ID NO 31 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 31 His Gly Glu Trp Arg Pro Ser Tyr Glu Lys Gln Glu Asp Glu Glu Glu 1 5 10 15 Lys Gln Lys Tyr Arg Tyr Gln Arg 20 <210> SEQ ID NO 32 <211> LENGTH: 19

<212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 32 Pro Ser Tyr Glu Lys Glu Glu Asp Glu Glu Glu Gly Gln Arg Glu Arg 1 5 10 15 Gly Arg Gln <210> SEQ ID NO 33 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 33 Lys Ser Lys Pro Arg Thr Leu Phe Leu Pro Gln Tyr Thr Asp Ala Asp 1 5 10 15 Phe Ile Leu Val Val Leu Ser Gly Lys Ala Thr Leu Thr Val 20 25 30 <210> SEQ ID NO 34 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 34 Ser Gln Ser Gln Lys Phe Arg Asp Glu His Gln Lys Ile His Gln Phe 1 5 10 15 Arg Gln Gly Asp Ile Val 20 <210> SEQ ID NO 35 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 35 Val Asn Ser Gln Lys Phe Pro Ile Leu Asn Leu Ile Gln Met Ser Ala 1 5 10 15 Thr Arg Val Asn Leu Tyr Gln 20 <210> SEQ ID NO 36 <211> LENGTH: 40 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 36 Tyr Ile Ala Ile Lys Thr Asn Ala Asn Ala Phe Val Ser His Leu Ala 1 5 10 15 Gly Lys Asn Ser Val Phe Arg Ala Leu Pro Val Asp Val Val Ala Asn 20 25 30 Ala Tyr Arg Ile Ser Arg Glu Gln 35 40 <210> SEQ ID NO 37 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 37 Ala Pro Ile Val Ala Val Tyr Val Tyr Asp Val Asn Asn Asn Ala Asn 1 5 10 15 Gln Leu Glu Pro Arg Gln Lys Glu Phe Leu Leu Ala Gly Asn Asn 20 25 30 <210> SEQ ID NO 38 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 38 Glu Asn Pro Ser Arg Ala Asp Ser Tyr Asn Pro Arg Ala Gly Arg Ile 1 5 10 15 Thr <210> SEQ ID NO 39 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 39 Gly Leu Gln Leu Leu Lys Pro Thr Leu Thr Gln Gln Gln Glu Gln Ala 1 5 10 15 Gln Ala Gln Asp Gln Tyr Gln Gln Val Gln Tyr Ser Glu Arg Gln Gln 20 25 30 <210> SEQ ID NO 40 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 40 Cys Arg Phe Asp Arg Leu Gln Ala Phe Glu Pro Leu Arg Lys Val Arg 1 5 10 15 Ser Glu <210> SEQ ID NO 41 <211> LENGTH: 48 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 41 Ile Leu Ser Pro Phe Trp Asn Val Asn Ala His Ser Leu Val Tyr Met 1 5 10 15 Ile Gln Gly Arg Ser Arg Val Gln Val Val Ser Asn Phe Gly Lys Thr 20 25 30 Val Phe Asp Gly Val Leu Arg Pro Gly Gln Leu Leu Ile Ile Pro Gln 35 40 45 <210> SEQ ID NO 42 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 42 Ala Phe Thr Pro Arg Phe Gln Gln Gln Tyr Tyr Pro Gly Leu Ser Asn 1 5 10 15 Glu Ser Glu Ser Glu Thr Ser Glu 20 <210> SEQ ID NO 43 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 43 Pro Arg Ala Gly Arg Val Thr Asn Leu Asn Thr Gln Asn Phe Pro Ile 1 5 10 15 Leu Ser Leu Val Gln Met Ser Ala Val Lys Val Asn Leu Tyr Gln 20 25 30 <210> SEQ ID NO 44 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 44 His Ser Val Val Tyr Ile Thr Gln Gly Arg Ala Arg Val Gln Val Val 1 5 10 15 Asn Asn Asn Gly Lys Thr Val Phe Asn Gly Glu Leu Arg Arg Gly Gln 20 25 30 <210> SEQ ID NO 45 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 45 His Ile Ala Gly Lys Ser Ser Ile Phe Arg Ala Leu Pro Asn Asp Val 1 5 10 15 Leu Ala Asn Ala Tyr Arg Ile Ser Arg Glu Glu Ala Gln Arg Leu Lys 20 25 30 <210> SEQ ID NO 46 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 46 Val Pro Val Val Ala Ile Tyr Val Thr Asp Leu Asn Asn Gly Ala Asn 1 5 10 15 Gln Leu Asp Pro Arg Gln Arg Asp Phe Leu Leu Ala Gly 20 25 <210> SEQ ID NO 47 <211> LENGTH: 52 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 47 Thr Phe Cys Thr Met Arg Val Arg Gln Asn Ile Asp Asn Pro Asn Arg

1 5 10 15 Ala Asp Thr Tyr Asn Pro Arg Ala Gly Arg Val Thr Asn Leu Asn Ser 20 25 30 Gln Asn Phe Pro Ile Leu Asn Leu Val Gln Met Ser Ala Val Lys Val 35 40 45 Asn Leu Tyr Gln 50 <210> SEQ ID NO 48 <211> LENGTH: 73 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 48 Tyr Ile Ala Phe Lys Thr Asn Pro Asn Ser Met Val Ser His Ile Ala 1 5 10 15 Gly Lys Ser Ser Ile Phe Arg Ala Leu Pro Thr Asp Val Leu Ala Asn 20 25 30 Ala Tyr Arg Ile Ser Arg Glu Glu Ala Gln Arg Leu Lys His Asn Arg 35 40 45 Gly Asp Glu Phe Gly Ala Phe Thr Pro Leu Gln Tyr Lys Ser Tyr Gln 50 55 60 Asp Val Tyr Asn Val Ala Glu Ser Ser 65 70 <210> SEQ ID NO 49 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 49 Ser Gln Ser His Lys Phe Lys Asp Glu His Gln Lys Ile His Arg Phe 1 5 10 15 Arg Gln Gly Asp Val Ile Ala Leu Pro Ala Gly Val Ala His Trp Cys 20 25 30 Tyr Asn Asp Gly 35 <210> SEQ ID NO 50 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 50 Thr Gln Gly Arg Ala Gln Val Gln Val Val Asn Asn Asn Gly Lys Thr 1 5 10 15 Val Phe Asn Gly Glu Leu Arg Arg Gly Gln Leu Leu Ile 20 25 <210> SEQ ID NO 51 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 51 Asn Gly Ala Ser Leu Val Tyr Ile Ile Gln Gly Arg Gly Ile Thr Gly 1 5 10 15 Pro Thr Phe Pro Gly Cys Pro Glu 20 <210> SEQ ID NO 52 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 52 Cys Arg Phe Asp Arg Leu Gln Ala Phe Glu Pro Ile Arg Ser Val Arg 1 5 10 15 Ser Gln Ala Gly Thr 20 <210> SEQ ID NO 53 <211> LENGTH: 40 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 53 Gln Asn Asp Gln Arg Gly Glu Ile Val Arg Val Glu Arg Gly Leu Ser 1 5 10 15 Leu Leu Gln Pro Tyr Ala Ser Leu Gln Glu Gln Glu Gln Gly Gln Met 20 25 30 Gln Ser Arg Glu His Tyr Gln Glu 35 40 <210> SEQ ID NO 54 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 54 Pro Arg Gln Arg Asp Phe Leu Leu Ala Gly Asn Lys Arg Asn Pro Gln 1 5 10 15 Ala Tyr Arg Arg Glu Val Glu Glu Trp Ser Gln Asn Ile Phe Ser Gly 20 25 30 Phe Ser Thr 35 <210> SEQ ID NO 55 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 55 Gly Gly Ile Tyr Arg Glu Leu Gly Ala Pro Asp Val Gly His Pro Met 1 5 10 15 Ser Glu Val Phe Arg Gly Cys 20 <210> SEQ ID NO 56 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 56 His Ser Leu Val Tyr Ile Val Gln Gly His Ala Arg Val Gln Val Val 1 5 10 15 Ser Asn Leu Gly Lys Thr Val Phe Asn Gly 20 25 <210> SEQ ID NO 57 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 57 Ala Arg Ser Leu Lys Asn Asn Arg Gly Glu Glu Leu Gly Ala Phe Thr 1 5 10 15 Pro Arg Tyr Gln Gln Gln Thr 20 <210> SEQ ID NO 58 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 58 Leu Asn Ser Gln Lys Phe Pro Ile Leu Asn Leu Val Gln Leu Ser Ala 1 5 10 15 Thr Arg Val Asn Leu Tyr Gln 20 <210> SEQ ID NO 59 <211> LENGTH: 84 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 59 Gln Met Tyr Gly Arg Ser Ile Glu Gln His Ser Gly Gln Asn Ile Phe 1 5 10 15 Ser Gly Phe Asn Asn Glu Leu Leu Ser Glu Ala Leu Gly Val Asn Ala 20 25 30 Leu Val Ala Lys Arg Leu Gln Gly Gln Asn Asp Gln Arg Gly Glu Ile 35 40 45 Ile Arg Val Lys Asn Gly Leu Lys Leu Leu Arg Pro Ala Phe Ala Gln 50 55 60 Gln Gln Glu Gln Ala Gln Gln Gln Glu Gln Ala Gln Ala Gln Tyr Gln 65 70 75 80 Val Gln Tyr Ser <210> SEQ ID NO 60 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 60 Ala Gln Leu Phe Gly Pro Asn Val Asn Pro Trp His Asn Pro Arg Gln 1 5 10 15 Gly Gly Phe Arg Glu Cys Arg Phe 20 <210> SEQ ID NO 61 <211> LENGTH: 23

<212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 61 Gly Val Ala His Trp Phe Tyr Asn Glu Gly Asp Ala Pro Val Val Ala 1 5 10 15 Leu Tyr Val Phe Asp Leu Asn 20 <210> SEQ ID NO 62 <211> LENGTH: 40 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 62 Tyr Ile Ser Phe Lys Thr Asn Ala Asn Ser Met Val Ser His Leu Ala 1 5 10 15 Gly Lys Asn Ser Ile Phe Arg Ala Met Pro Val Asp Val Ile Ala Asn 20 25 30 Ala Tyr Arg Ile Ser Arg Glu Gln 35 40 <210> SEQ ID NO 63 <211> LENGTH: 38 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 63 Lys Gly Pro Ala Lys Asn Trp Glu Asn Val Leu Leu Gly Leu Gly Val 1 5 10 15 Ala Gly Ser Ala Pro Gly Ile Glu Gly Asp Glu Ile Ala Pro Leu Ala 20 25 30 Lys Glu Asn Val Ala Ala 35 <210> SEQ ID NO 64 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 64 Arg Ala Val Val Lys Phe Asn Ala Pro Leu Ala His Leu Ile Met Ala 1 5 10 15 Gly Ala Asp Val Leu Ala Val Pro Ser Arg Phe Glu Pro Cys Gly 20 25 30 <210> SEQ ID NO 65 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 65 Lys Arg Ala Ile Lys Val Val Gly Thr Pro Ala Tyr Glu Glu Met Val 1 5 10 15 Arg Asn Cys Met Asn Gln 20 <210> SEQ ID NO 66 <211> LENGTH: 55 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 66 Ala Pro Trp Ser Lys Thr Gly Gly Leu Gly Asp Val Leu Gly Gly Leu 1 5 10 15 Pro Pro Ala Met Ala Ala Asn Gly His Arg Val Met Val Ile Ser Pro 20 25 30 Arg Tyr Asp Gln Tyr Lys Asp Ala Trp Asp Thr Ser Val Val Ala Glu 35 40 45 Ile Lys Val Ala Asp Arg Tyr 50 55 <210> SEQ ID NO 67 <211> LENGTH: 109 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 67 Ile Asn Trp Met Lys Ala Gly Ile Leu Glu Ala Asp Arg Val Leu Thr 1 5 10 15 Val Ser Pro Tyr Tyr Ala Glu Glu Leu Ile Ser Gly Ile Ala Arg Gly 20 25 30 Cys Glu Leu Asp Asn Ile Met Arg Leu Thr Gly Ile Thr Gly Ile Val 35 40 45 Asn Gly Met Asp Val Ser Glu Trp Asp Pro Ser Lys Asp Lys Tyr Ile 50 55 60 Thr Ala Lys Tyr Asp Ala Thr Thr Ala Ile Glu Ala Lys Ala Leu Asn 65 70 75 80 Lys Glu Ala Leu Gln Ala Glu Ala Gly Leu Pro Val Asp Arg Lys Ile 85 90 95 Pro Leu Ile Ala Phe Ile Gly Arg Leu Glu Glu Gln Lys 100 105 <210> SEQ ID NO 68 <211> LENGTH: 45 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 68 Arg Gly Val Asp Arg Val Phe Ile Asp His Pro Ser Phe Leu Glu Lys 1 5 10 15 Val Trp Gly Lys Thr Gly Glu Lys Ile Tyr Gly Pro Asp Thr Gly Val 20 25 30 Asp Tyr Lys Asp Asn Gln Met Arg Phe Ser Leu Leu Cys 35 40 45 <210> SEQ ID NO 69 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 69 Leu Glu Ala Pro Arg Ile Leu Asn Leu Asn Asn Asn Pro Tyr Phe Lys 1 5 10 15 Gly Thr Tyr Gly Glu 20 <210> SEQ ID NO 70 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 70 Tyr Ile Gln Val Glu Ala Pro Thr Gly Thr Phe Ile Ala Ser Gly Val 1 5 10 15 Val Val Gly Lys Asp Thr Leu Leu Thr Asn 20 25 <210> SEQ ID NO 71 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 71 Ser Arg Gly Pro Ile Tyr Ser Asn Glu Phe Gly Lys 1 5 10 <210> SEQ ID NO 72 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 72 Asn Ser Phe Asn Leu Glu Arg 1 5 <210> SEQ ID NO 73 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 73 Val Leu Asp Leu Ala Ile Pro Val Asn Arg 1 5 10 <210> SEQ ID NO 74 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 74 Asp Asp Asn Glu Glu Leu Arg 1 5 <210> SEQ ID NO 75 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 75 Leu Ser Ser Gly Asp Val Phe Val Ile Pro Ala Gly His Pro Val Ala 1 5 10 15

Val Lys <210> SEQ ID NO 76 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 76 Glu Asp Asp Glu Glu Glu Glu Gln Gly Glu Glu Glu Ile Asn Lys 1 5 10 15 <210> SEQ ID NO 77 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 77 Asn Ile Leu Glu Ala Ser Phe Asn Thr Asp Tyr Glu Glu Ile Glu Lys 1 5 10 15 Val Leu Leu Glu Glu His Glu Lys Glu Thr Gln His Arg 20 25 <210> SEQ ID NO 78 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 78 Asn Ile Leu Glu Ala Ser Phe Asn Thr Asp Tyr Glu Glu Ile Glu Lys 1 5 10 15 Val Leu Leu Glu Glu His Glu Lys 20 <210> SEQ ID NO 79 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 79 Asn Ile Leu Glu Ala Ser Phe Asn Thr Asp Tyr Glu Glu Ile Glu Lys 1 5 10 15 <210> SEQ ID NO 80 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 80 Arg Gln Gln Ser Gln Glu Glu Asn Val Ile Val Lys 1 5 10 <210> SEQ ID NO 81 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 81 Gln Gln Ser Gln Glu Glu Asn Val Ile Val Lys 1 5 10 <210> SEQ ID NO 82 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 82 Leu Ser Arg Gly Gln Ile Glu Glu Leu Ser Lys 1 5 10 <210> SEQ ID NO 83 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 83 Gly Gln Ile Glu Glu Leu Ser Lys 1 5 <210> SEQ ID NO 84 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 84 Val Leu Leu Glu Glu His Glu Lys 1 5 <210> SEQ ID NO 85 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 85 Ser Lys Pro His Thr Ile Phe Leu Pro Gln His Thr Asp Ala Asp Tyr 1 5 10 15 Ile Leu Val Val Leu Ser Gly Lys 20 <210> SEQ ID NO 86 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 86 Pro His Thr Ile Phe Leu Pro Gln His Thr Asp Ala Asp Tyr Ile Leu 1 5 10 15 Val Val Leu Ser Gly Lys 20 <210> SEQ ID NO 87 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 87 Ser Asn Lys Phe Gln Thr Leu Phe Glu Asn Glu Asn Gly His Ile Arg 1 5 10 15 <210> SEQ ID NO 88 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 88 Ser Lys Ile Phe Glu Asn Leu Gln Asn Tyr Arg 1 5 10 <210> SEQ ID NO 89 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 89 Ile Phe Glu Asn Leu Gln Asn Tyr Arg 1 5 <210> SEQ ID NO 90 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 90 Ile Leu Glu Asn Gln Lys Gln Ser His Phe Ala Asp Ala Gln Pro Gln 1 5 10 15 Gln Arg <210> SEQ ID NO 91 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 91 Pro Gly Gln Leu Gln Ser Phe Leu Leu Ser Gly Asn Gln Asn Gln Gln 1 5 10 15 Asn Tyr Leu Ser Gly Phe Ser Lys 20 <210> SEQ ID NO 92 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 92 Phe Phe Glu Leu Thr Pro Glu Lys Asn Gln Gln Leu Gln Asp Leu Asp 1 5 10 15 Leu Phe Val Asn Ser Val Asp Leu Lys 20 25 <210> SEQ ID NO 93 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide

<400> SEQUENCE: 93 Gln Leu Glu Glu Leu Ser Lys 1 5 <210> SEQ ID NO 94 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 94 Gln Glu Glu Asp Glu Asp Glu Asp Glu Glu Arg 1 5 10 <210> SEQ ID NO 95 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 95 Tyr Gln His Gln Gln Gly Gly Lys Gln Glu Gln Glu Asn Glu Gly Asn 1 5 10 15 Asn Ile Phe Ser Gly Phe Lys 20 <210> SEQ ID NO 96 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 96 Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr Thr Ser Tyr Leu Val Asn 1 5 10 15 Gln Asp Asp Glu Glu Asp Leu Arg 20 <210> SEQ ID NO 97 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 97 Arg Gln Gln Gly Glu Glu Thr Asp Ala Ile Val Lys 1 5 10 <210> SEQ ID NO 98 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 98 Val Leu Leu Glu Glu Gln Glu Lys Asp Arg Lys 1 5 10 <210> SEQ ID NO 99 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 99 Asn Ile Leu Glu Ala Ser Tyr Asn Thr Arg 1 5 10 <210> SEQ ID NO 100 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 100 Phe Glu Ala Phe Asp Leu Ala Lys 1 5 <210> SEQ ID NO 101 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 101 Glu Gln Ile Glu Glu Leu Lys Lys 1 5 <210> SEQ ID NO 102 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 102 Glu Gln Ile Glu Glu Leu Lys 1 5 <210> SEQ ID NO 103 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 103 Asn Lys Asn Gln Tyr Leu Arg 1 5 <210> SEQ ID NO 104 <211> LENGTH: 37 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 104 Leu Ser Pro Gly Asp Val Val Ile Ile Pro Ala Gly His Pro Val Ala 1 5 10 15 Ile Thr Ala Ser Ser Asn Leu Asn Leu Leu Gly Phe Gly Ile Asn Ala 20 25 30 Glu Asn Asn Glu Arg 35 <210> SEQ ID NO 105 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 105 Pro Ser Tyr Glu Lys Gln Glu Asp Glu Glu Glu Lys Gln Lys 1 5 10 <210> SEQ ID NO 106 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 106 Glu Glu Asp Glu Glu Glu Gly Gln Arg 1 5 <210> SEQ ID NO 107 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 107 Thr Leu Phe Leu Pro Gln Tyr Thr Asp Ala Asp Phe Ile Leu Val Val 1 5 10 15 Leu Ser Gly Lys 20 <210> SEQ ID NO 108 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 108 Gly Tyr Val Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr His Gln Gln 1 5 10 15 Gln Phe Gln Leu Phe Glu Gln Arg 20 <210> SEQ ID NO 109 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 109 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 110 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 110 Leu Val Asp Leu Val Ile Pro Val Asn Gly Pro Gly Lys Phe Glu Ala 1 5 10 15 Phe Asp Leu Ala Lys 20 <210> SEQ ID NO 111 <211> LENGTH: 18

<212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 111 Lys Asn Pro Gln Leu Gln Asp Leu Asp Ile Phe Val Asn Tyr Val Glu 1 5 10 15 Ile Lys <210> SEQ ID NO 112 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 112 Asp Glu His Gln Lys Ile His Gln Phe Arg 1 5 10 <210> SEQ ID NO 113 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 113 Phe Arg Asp Glu His Gln Lys 1 5 <210> SEQ ID NO 114 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 114 Phe Pro Ile Leu Asn Leu Ile Gln Met Ser Ala Thr Arg 1 5 10 <210> SEQ ID NO 115 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 115 Thr Asn Ala Asn Ala Phe Val Ser His Leu Ala Gly Lys 1 5 10 <210> SEQ ID NO 116 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 116 Ala Leu Pro Val Asp Val Val Ala Asn Ala Tyr Arg 1 5 10 <210> SEQ ID NO 117 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 117 Tyr Val Tyr Asp Val Asn Asn Asn Ala Asn Gln Leu Glu Pro Arg Gln 1 5 10 15 Lys Glu Phe Leu 20 <210> SEQ ID NO 118 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 118 Val Tyr Val Tyr Asp Val Asn Asn Asn Ala Asn Gln Leu Glu Pro Arg 1 5 10 15 Gln Lys Glu Phe Leu 20 <210> SEQ ID NO 119 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 119 Ala Asp Ser Tyr Asn Pro Arg 1 5 <210> SEQ ID NO 120 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 120 Lys Pro Thr Leu Thr Gln Gln Gln Glu Gln Ala Gln Ala Gln Asp Gln 1 5 10 15 <210> SEQ ID NO 121 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 121 Gln Ala Gln Ala Gln Asp Gln Tyr Gln Gln Val Gln Tyr 1 5 10 <210> SEQ ID NO 122 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 122 Gln Ala Gln Asp Gln Tyr Gln Gln Val Gln Tyr 1 5 10 <210> SEQ ID NO 123 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 123 Leu Gln Ala Phe Glu Pro Leu Arg 1 5 <210> SEQ ID NO 124 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 124 Ser Arg Val Gln Val Val Ser Asn Phe Gly Lys 1 5 10 <210> SEQ ID NO 125 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 125 Trp Asn Val Asn Ala His Ser Leu Val Tyr 1 5 10 <210> SEQ ID NO 126 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 126 Asn Val Asn Ala His Ser Leu Val Tyr 1 5 <210> SEQ ID NO 127 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 127 Ile Gln Gly Arg Ser Arg Val Gln Val Val Ser Asn Phe Gly Lys 1 5 10 15 <210> SEQ ID NO 128 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 128 Gly Lys Thr Val Phe Asp Gly Val Leu Arg Pro Gly Gln Leu 1 5 10 <210> SEQ ID NO 129 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 129 Phe Gly Lys Thr Val Phe Asp Gly Val Leu Arg Pro Gly Gln Leu 1 5 10 15

<210> SEQ ID NO 130 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 130 Phe Gln Gln Gln Tyr Tyr Pro Gly Leu Ser Asn Glu Ser Glu Ser Glu 1 5 10 15 Thr Ser Glu <210> SEQ ID NO 131 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 131 Gln Gln Tyr Tyr Pro Gly Leu Ser Asn 1 5 <210> SEQ ID NO 132 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 132 Gln Gln Gln Tyr Tyr Pro Gly Leu Ser Asn 1 5 10 <210> SEQ ID NO 133 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 133 Val Thr Asn Leu Asn Thr Gln Asn Phe Pro Ile Leu Ser Leu Val Gln 1 5 10 15 Met Ser Ala Val Lys 20 <210> SEQ ID NO 134 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 134 Ile Thr Gln Gly Arg Ala Arg Val Gln Val Val Asn Asn Asn Gly Lys 1 5 10 15 Thr Val Phe <210> SEQ ID NO 135 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 135 Ile Thr Gln Gly Arg Ala Arg Val Gln Val Val Asn Asn Asn Gly Lys 1 5 10 15 Thr Val Phe Asn Gly Glu 20 <210> SEQ ID NO 136 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 136 Ile Thr Gln Gly Arg Ala Arg Val Gln Val Val Asn Asn Asn Gly Lys 1 5 10 15 Thr Val Phe Asn Gly 20 <210> SEQ ID NO 137 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 137 Arg Val Gln Val Val Asn Asn Asn Gly Lys Thr Val Phe 1 5 10 <210> SEQ ID NO 138 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 138 Arg Ala Leu Pro Asn Asp Val Leu Ala Asn Ala Tyr Arg Ile Ser Arg 1 5 10 15 Glu Glu <210> SEQ ID NO 139 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 139 Ser Ile Phe Arg Ala Leu Pro Asn Asp Val Leu Ala Asn Ala Tyr Arg 1 5 10 15 <210> SEQ ID NO 140 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 140 Ser Ile Phe Arg Ala Leu Pro Asn Asp Val Leu Ala Asn Ala Tyr 1 5 10 15 <210> SEQ ID NO 141 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 141 Ser Ile Phe Arg Ala Leu Pro Asn Asp Val Leu Ala Asn 1 5 10 <210> SEQ ID NO 142 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 142 Ser Ser Ile Phe Arg Ala Leu Pro Asn Asp Val Leu Ala Asn Ala Tyr 1 5 10 15 Arg <210> SEQ ID NO 143 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 143 Ser Ile Phe Arg Ala Leu Pro Asn Asp Val Leu Ala Asn Ala Tyr Arg 1 5 10 15 Ile Ser Arg Glu Glu 20 <210> SEQ ID NO 144 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 144 Ser Ile Phe Arg Ala Leu Pro Asn Asp 1 5 <210> SEQ ID NO 145 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 145 Ile Tyr Val Thr Asp Leu Asn Asn Gly Ala Asn Gln Leu Asp Pro Arg 1 5 10 15 Gln Arg Asp <210> SEQ ID NO 146 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 146 Val Thr Asn Leu Asn Ser Gln Asn Phe Pro Ile Leu Asn Leu Val Gln 1 5 10 15 Met Ser Ala Val Lys 20 <210> SEQ ID NO 147 <211> LENGTH: 8 <212> TYPE: PRT

<213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 147 Gln Asn Ile Asp Asn Pro Asn Arg 1 5 <210> SEQ ID NO 148 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 148 Ala Asp Thr Tyr Asn Pro Arg 1 5 <210> SEQ ID NO 149 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 149 Asn Ile Asp Asn Pro Asn Arg Ala Asp Thr Tyr Asn Pro Arg Ala Gly 1 5 10 15 Arg Val Thr Asn Leu 20 <210> SEQ ID NO 150 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 150 Arg Val Arg Gln Asn Ile Asp Asn Pro Asn Arg Ala Asp Thr Tyr Asn 1 5 10 15 Pro Arg Ala Gly Arg Val Thr Asn Leu 20 25 <210> SEQ ID NO 151 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 151 Thr Asn Pro Asn Ser Met Val Ser His Ile Ala Gly Lys Ser Ser Ile 1 5 10 15 Phe Arg <210> SEQ ID NO 152 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 152 His Asn Arg Gly Asp Glu Phe Gly Ala Phe Thr Pro Leu Gln Tyr Lys 1 5 10 15 <210> SEQ ID NO 153 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 153 Ser Tyr Gln Asp Val Tyr Asn Val Ala Glu Ser Ser 1 5 10 <210> SEQ ID NO 154 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 154 Ile Ser Arg Glu Glu Ala Gln Arg 1 5 <210> SEQ ID NO 155 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 155 Ser Ile Phe Arg Ala Leu Pro Thr Asp Val Leu Ala Asn Ala Tyr Arg 1 5 10 15 Ile Ser Arg Glu Glu 20 <210> SEQ ID NO 156 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 156 Tyr Arg Ile Ser Arg Glu Glu Ala Gln Arg Leu Lys His Asn Arg Gly 1 5 10 15 Asp Glu Phe <210> SEQ ID NO 157 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 157 Tyr Arg Ile Ser Arg Glu Glu Ala Gln Arg Leu Lys His Asn Arg Gly 1 5 10 15 Asp Glu <210> SEQ ID NO 158 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 158 Phe Lys Asp Glu His Gln Lys Ile His Arg 1 5 10 <210> SEQ ID NO 159 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 159 Gln Gly Asp Val Ile Ala Leu Pro Ala Gly Val Ala His Trp 1 5 10 <210> SEQ ID NO 160 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 160 Thr Val Phe Asn Gly Glu Leu Arg Arg 1 5 <210> SEQ ID NO 161 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 161 Thr Val Phe Asn Gly Glu Leu Arg 1 5 <210> SEQ ID NO 162 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 162 Gln Val Gln Val Val Asn Asn Asn Gly Lys Thr Val Phe 1 5 10 <210> SEQ ID NO 163 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 163 Tyr Ile Ile Gln Gly Arg Gly Ile Thr Gly Pro Thr Phe 1 5 10 <210> SEQ ID NO 164 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 164 Val Tyr Ile Ile Gln Gly Arg Gly Ile Thr Gly Pro Thr Phe 1 5 10 <210> SEQ ID NO 165 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:

<223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 165 Leu Gln Ala Phe Glu Pro Ile Arg Ser Val Arg 1 5 10 <210> SEQ ID NO 166 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 166 Gly Leu Ser Leu Leu Gln Pro Tyr Ala Ser Leu Gln Glu Gln Glu Gln 1 5 10 15 Gly Gln Met Gln Ser Arg 20 <210> SEQ ID NO 167 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 167 Gly Glu Ile Val Arg Val Glu Arg 1 5 <210> SEQ ID NO 168 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 168 Arg Gly Leu Ser Leu Leu Gln Pro Tyr Ala Ser Leu Gln 1 5 10 <210> SEQ ID NO 169 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 169 Arg Gly Leu Ser Leu Leu Gln Pro Tyr Ala Ser Leu Gln Glu Gln 1 5 10 15 <210> SEQ ID NO 170 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 170 Arg Gly Leu Ser Leu Leu Gln Pro Tyr Ala Ser Leu Gln Glu Gln Glu 1 5 10 15 <210> SEQ ID NO 171 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 171 Arg Gly Leu Ser Leu Leu Gln Pro Tyr Ala Ser Leu Gln Glu 1 5 10 <210> SEQ ID NO 172 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 172 Arg Asn Pro Gln Ala Tyr Arg 1 5 <210> SEQ ID NO 173 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 173 Phe Leu Leu Ala Gly Asn Lys Arg Asn Pro Gln Ala Tyr 1 5 10 <210> SEQ ID NO 174 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 174 Glu Val Glu Glu Trp Ser Gln Asn Ile Phe 1 5 10 <210> SEQ ID NO 175 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 175 Leu Ala Gly Asn Lys Arg Asn Pro Gln Ala Tyr Arg 1 5 10 <210> SEQ ID NO 176 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 176 Phe Leu Leu Ala Gly Asn Lys Arg Asn Pro Gln Ala 1 5 10 <210> SEQ ID NO 177 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 177 Glu Leu Gly Ala Pro Asp Val Gly His Pro Met Ser Glu 1 5 10 <210> SEQ ID NO 178 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 178 Ile Val Gln Gly His Ala Arg Val Gln Val Val Ser Asn Leu Gly Lys 1 5 10 15 <210> SEQ ID NO 179 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 179 Ile Val Gln Gly His Ala Arg Val Gln Val Val Ser Asn Leu 1 5 10 <210> SEQ ID NO 180 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 180 Ile Val Gln Gly His Ala Arg Val Gln Val Val Ser Asn 1 5 10 <210> SEQ ID NO 181 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 181 Asn Asn Arg Gly Glu Glu Leu Gly Ala Phe Thr Pro Arg 1 5 10 <210> SEQ ID NO 182 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 182 Gly Glu Glu Leu Gly Ala Phe Thr Pro Arg 1 5 10 <210> SEQ ID NO 183 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 183 Phe Pro Ile Leu Asn Leu Val Gln Leu Ser Ala Thr Arg 1 5 10 <210> SEQ ID NO 184 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide

<400> SEQUENCE: 184 Ser Ile Glu Gln His Ser Gly Gln Asn Ile Phe Ser Gly Phe Asn Asn 1 5 10 15 Glu Leu Leu Ser Glu Ala Leu Gly Val Asn Ala Leu Val Ala Lys 20 25 30 <210> SEQ ID NO 185 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 185 Leu Gln Gly Gln Asn Asp Gln Arg 1 5 <210> SEQ ID NO 186 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 186 Ser Gly Phe Asn Asn Glu Leu Leu Ser Glu Ala Leu Gly Val Asn Ala 1 5 10 15 Leu Val Ala Lys 20 <210> SEQ ID NO 187 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 187 Pro Ala Phe Ala Gln Gln Gln Glu Gln Ala Gln Gln Gln Glu Gln Ala 1 5 10 15 Gln Ala Gln Tyr 20 <210> SEQ ID NO 188 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 188 Val Ala Lys Arg Leu Gln Gly Gln Asn Asp Gln Arg Gly Glu Ile 1 5 10 15 <210> SEQ ID NO 189 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 189 Ala Leu Val Ala Lys Arg Leu Gln Gly Gln Asn Asp Gln Arg Gly Glu 1 5 10 15 Ile <210> SEQ ID NO 190 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 190 Leu Gln Gly Gln Asn Asp Gln Arg Gly Glu Ile Ile Arg 1 5 10 <210> SEQ ID NO 191 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 191 Pro Asn Val Asn Pro Trp His Asn Pro Arg Gln Gly Gly Phe 1 5 10 <210> SEQ ID NO 192 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 192 Phe Tyr Asn Glu Gly Asp Ala Pro Val Val Ala Leu Tyr 1 5 10 <210> SEQ ID NO 193 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 193 Phe Tyr Asn Glu Gly Asp Ala Pro Val Val 1 5 10 <210> SEQ ID NO 194 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 194 Phe Tyr Asn Glu Gly Asp Ala Pro Val Val Ala Leu 1 5 10 <210> SEQ ID NO 195 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 195 Phe Tyr Asn Glu Gly Asp Ala Pro Val Val Ala 1 5 10 <210> SEQ ID NO 196 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 196 Thr Asn Ala Asn Ser Met Val Ser His Leu Ala Gly Lys 1 5 10 <210> SEQ ID NO 197 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 197 Ala Met Pro Val Asp Val Ile Ala Asn Ala Tyr Arg 1 5 10 <210> SEQ ID NO 198 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 198 Asn Trp Glu Asn Val Leu Leu Gly Leu Gly Val Ala Gly Ser Ala Pro 1 5 10 15 Gly Ile Glu Gly Asp Glu Ile Ala Pro Leu Ala Lys 20 25 <210> SEQ ID NO 199 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 199 Asn Val Leu Leu Gly Leu Gly Val Ala Gly Ser Ala Pro Gly Ile Glu 1 5 10 15 Gly Asp Glu <210> SEQ ID NO 200 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 200 Asn Trp Glu Asn Val Leu Leu Gly Leu Gly Val Ala Gly Ser Ala Pro 1 5 10 15 Gly Ile Glu Gly Asp Glu Ile Ala Pro Leu Ala Lys 20 25 <210> SEQ ID NO 201 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 201 Phe Asn Ala Pro Leu Ala His Leu Ile Met Ala Gly Ala Asp Val Leu 1 5 10 15 Ala Val Pro Ser Arg 20 <210> SEQ ID NO 202

<211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 202 Phe Asn Ala Pro Leu Ala His Leu Ile Met 1 5 10 <210> SEQ ID NO 203 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 203 Phe Asn Ala Pro Leu Ala His Leu Ile Met Ala Gly Ala Asp Val Leu 1 5 10 15 Ala Val Pro Ser Arg 20 <210> SEQ ID NO 204 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 204 Val Val Gly Thr Pro Ala Tyr Glu Glu Met Val Arg 1 5 10 <210> SEQ ID NO 205 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 205 Thr Gly Gly Leu Gly Asp Val Leu Gly Gly Leu Pro Pro Ala Met Ala 1 5 10 15 Ala Asn Gly His Arg 20 <210> SEQ ID NO 206 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 206 Tyr Asp Gln Tyr Lys Asp Ala Trp Asp Thr Ser Val Val Ala Glu Ile 1 5 10 15 Lys <210> SEQ ID NO 207 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 207 Asp Ala Trp Asp Thr Ser Val Val Ala Glu Ile Lys 1 5 10 <210> SEQ ID NO 208 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 208 Val Met Val Ile Ser Pro Arg 1 5 <210> SEQ ID NO 209 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 209 Leu Thr Gly Ile Thr Gly Ile Val Asn Gly Met Asp Val Ser Glu Trp 1 5 10 15 Asp Pro Ser Lys Asp Lys 20 <210> SEQ ID NO 210 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 210 Val Leu Thr Val Ser Pro Tyr Tyr Ala Glu Glu Leu Ile Ser Gly Ile 1 5 10 15 Ala Arg <210> SEQ ID NO 211 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 211 Glu Ala Leu Gln Ala Glu Ala Gly Leu Pro Val Asp Arg Lys 1 5 10 <210> SEQ ID NO 212 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 212 Tyr Asp Ala Thr Thr Ala Ile Glu Ala Lys 1 5 10 <210> SEQ ID NO 213 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 213 Ile Pro Leu Ile Ala Phe Ile Gly Arg 1 5 <210> SEQ ID NO 214 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 214 Ala Gly Ile Leu Glu Ala Asp Arg 1 5 <210> SEQ ID NO 215 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 215 Ile Pro Leu Ile Ala Phe Ile Gly Arg 1 5 <210> SEQ ID NO 216 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 216 Val Phe Ile Asp His Pro Ser Phe Leu Glu Lys 1 5 10 <210> SEQ ID NO 217 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 217 Gly Pro Asp Thr Gly Val Asp Tyr Lys Asp Asn Gln Met 1 5 10 <210> SEQ ID NO 218 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 218 Ile Tyr Gly Pro Asp Thr Gly Val Asp Tyr Lys Asp Asn Gln Met Arg 1 5 10 15 <210> SEQ ID NO 219 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 219 Ile Tyr Gly Pro Asp Thr Gly Val Asp Tyr Lys 1 5 10 <210> SEQ ID NO 220 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:

<223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 220 Ile Leu Asn Leu Asn Asn Asn Pro Tyr Phe Lys 1 5 10 <210> SEQ ID NO 221 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 221 Ala Pro Thr Gly Thr Phe Ile Ala Ser Gly Val Val Val Gly Lys Asp 1 5 10 15 <210> SEQ ID NO 222 <211> LENGTH: 463 <212> TYPE: PRT <213> ORGANISM: Vicia faba <400> SEQUENCE: 222 Met Ala Ala Thr Thr Leu Lys Asp Ser Phe Pro Leu Leu Thr Leu Leu 1 5 10 15 Gly Ile Ala Phe Leu Ala Ser Val Cys Leu Ser Ser Arg Ser Asp Gln 20 25 30 Asp Asn Pro Phe Val Phe Glu Ser Asn Arg Phe Gln Thr Leu Phe Glu 35 40 45 Asn Glu Asn Gly His Ile Arg Leu Leu Gln Lys Phe Asp Gln His Ser 50 55 60 Lys Leu Leu Glu Asn Leu Gln Asn Tyr Arg Leu Leu Glu Tyr Lys Ser 65 70 75 80 Lys Pro His Thr Ile Phe Leu Pro Gln Gln Thr Asp Ala Asp Phe Ile 85 90 95 Leu Val Val Leu Ser Gly Lys Ala Ile Leu Thr Val Leu Leu Pro Asn 100 105 110 Asp Arg Asn Ser Phe Ser Leu Glu Arg Gly Asp Thr Ile Lys Leu Pro 115 120 125 Ala Gly Thr Ile Gly Tyr Leu Val Asn Arg Asp Asp Glu Glu Asp Leu 130 135 140 Arg Val Leu Asp Leu Val Ile Pro Val Asn Arg Pro Gly Glu Pro Gln 145 150 155 160 Ser Phe Leu Leu Ser Gly Asn Gln Asn Gln Pro Ser Ile Leu Ser Gly 165 170 175 Phe Ser Lys Asn Ile Leu Glu Ala Ser Phe Asn Thr Asp Tyr Lys Glu 180 185 190 Ile Glu Lys Val Leu Leu Glu Glu His Gly Lys Glu Lys Tyr His Arg 195 200 205 Arg Gly Leu Lys Asp Arg Arg Gln Arg Gly Gln Glu Glu Asn Val Ile 210 215 220 Val Lys Ile Ser Arg Lys Gln Ile Glu Glu Leu Asn Lys Asn Ala Lys 225 230 235 240 Ser Ser Ser Lys Lys Ser Thr Ser Ser Glu Ser Glu Pro Phe Asn Leu 245 250 255 Arg Ser Arg Glu Pro Ile Tyr Ser Asn Lys Phe Gly Lys Phe Phe Glu 260 265 270 Ile Thr Pro Lys Arg Asn Pro Gln Leu Gln Asp Leu Asn Ile Phe Val 275 280 285 Asn Tyr Val Glu Ile Asn Glu Gly Ser Leu Leu Leu Pro His Tyr Asn 290 295 300 Ser Arg Ala Ile Val Ile Val Thr Val Asn Glu Gly Lys Gly Asp Phe 305 310 315 320 Glu Leu Val Gly Gln Arg Asn Glu Asn Gln Gln Gly Leu Arg Glu Glu 325 330 335 Tyr Asp Glu Glu Lys Glu Gln Gly Glu Glu Glu Ile Arg Lys Gln Val 340 345 350 Gln Asn Tyr Lys Ala Lys Leu Ser Pro Gly Asp Val Leu Val Ile Pro 355 360 365 Ala Gly Tyr Pro Val Ala Ile Lys Ala Ser Ser Asn Leu Asn Leu Val 370 375 380 Gly Phe Gly Ile Asn Ala Glu Asn Asn Gln Arg Tyr Phe Leu Ala Gly 385 390 395 400 Glu Glu Asp Asn Val Ile Ser Gln Ile His Lys Pro Val Lys Glu Leu 405 410 415 Ala Phe Pro Gly Ser Ala Gln Glu Val Asp Thr Leu Leu Glu Asn Gln 420 425 430 Lys Gln Ser His Phe Ala Asn Ala Gln Pro Arg Glu Arg Glu Arg Gly 435 440 445 Ser Gln Glu Ile Lys Asp His Leu Tyr Ser Ile Leu Gly Ser Phe 450 455 460 <210> SEQ ID NO 223 <211> LENGTH: 446 <212> TYPE: PRT <213> ORGANISM: Cicer arietinum <400> SEQUENCE: 223 Met Ala Ile Lys Ala Arg Phe Pro Leu Leu Val Leu Leu Gly Ile Val 1 5 10 15 Phe Leu Ala Ser Val Cys Ala Lys Ser Asp Lys Glu Asn Pro Phe Phe 20 25 30 Phe Lys Ser Asn Asn Cys Gln Thr Leu Phe Glu Asn Glu Asn Gly His 35 40 45 Val Arg Leu Leu Gln Arg Phe Asp Lys Arg Ser Gln Leu Phe Glu Asn 50 55 60 Leu Gln Asn Tyr Arg Leu Met Glu Tyr Asn Ser Lys Pro His Thr Leu 65 70 75 80 Phe Leu Pro Gln His Asn Asp Ala Asp Phe Ile Leu Val Val Leu Arg 85 90 95 Gly Arg Ala Ile Leu Thr Val Leu Asn Pro Asn Asp Arg Asn Thr Phe 100 105 110 Lys Leu Glu Arg Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr Ile Ala 115 120 125 Tyr Leu Ala Asn Arg Asp Asp Asn Glu Asp Leu Arg Val Leu Asp Leu 130 135 140 Ala Ile Pro Val Asn Arg Pro Gly Gln Phe Gln Ser Phe Ser Leu Ser 145 150 155 160 Gly Asn Glu Asn Gln Gln Ser Tyr Phe Gln Gly Phe Ser Lys Lys Ile 165 170 175 Leu Glu Ala Ser Phe Asn Ser Asp Tyr Glu Glu Ile Glu Arg Val Leu 180 185 190 Leu Glu Glu Gln Glu Gln Lys Pro Glu Gln Arg Arg Gly His Lys Gly 195 200 205 Arg Gln Gln Ser Gln Glu Thr Asp Val Ile Val Lys Ile Ser Arg Glu 210 215 220 Gln Ile Glu Glu Leu Ser Lys Asn Ala Lys Ser Asn Cys Lys Lys Ser 225 230 235 240 Val Ser Ser Glu Ser Glu Pro Phe Asn Leu Arg Ser Arg Ser Pro Ile 245 250 255 Tyr Ser Asn Arg Phe Gly Asn Phe Phe Glu Ile Thr Pro Glu Lys Asn 260 265 270 Pro Gln Leu Lys Asp Leu Asp Ile Phe Val Asn Ser Val Glu Ile Lys 275 280 285 Glu Gly Ser Leu Leu Leu Pro His Phe Asn Ser Arg Ala Thr Val Ile 290 295 300 Leu Val Val Asn Glu Gly Lys Gly Glu Val Glu Leu Val Gly Leu Arg 305 310 315 320 Asn Glu Asn Glu Gln Glu Asn Lys Lys Glu Asp Glu Glu Glu Glu Glu 325 330 335 Asp Arg Asn Val Gln Val Gln Arg Phe Gln Ser Lys Leu Ser Ser Gly 340 345 350 Asp Val Val Val Ile Pro Ala Ser His Pro Phe Ser Ile Asn Ala Ser 355 360 365 Ser Asp Leu Phe Leu Leu Gly Phe Gly Ile Asn Ala Gln Asn Asn Gln 370 375 380 Arg Asn Phe Leu Ala Gly Glu Glu Asp Asn Val Ile Ser Gln Ile Gln 385 390 395 400 Arg Pro Val Lys Glu Val Ala Phe Pro Gly Ser Ala Glu Glu Val Asp 405 410 415 Arg Leu Leu Lys Asn Gln Arg Gln Ser His Phe Ala Asn Ala Gln Pro 420 425 430 Gln Gln Lys Arg Lys Gly Ser Gln Arg Ile Arg Ser Pro Phe 435 440 445 <210> SEQ ID NO 224 <211> LENGTH: 418 <212> TYPE: PRT <213> ORGANISM: Lens culinaris <400> SEQUENCE: 224 Ser Arg Ser Asp Gln Glu Asn Pro Phe Ile Phe Lys Ser Asn Arg Phe 1 5 10 15 Gln Thr Ile Tyr Glu Asn Glu Asn Gly His Ile Arg Leu Leu Gln Arg 20 25 30 Phe Asp Lys Arg Ser Lys Ile Phe Glu Asn Leu Gln Asn Tyr Arg Leu 35 40 45 Leu Glu Tyr Lys Ser Lys Pro His Thr Ile Phe Leu Pro Gln Phe Thr 50 55 60 Asp Ala Asp Phe Ile Leu Val Val Leu Ser Gly Lys Ala Ile Leu Thr 65 70 75 80 Val Leu Asn Ser Asn Asp Arg Asn Ser Phe Asn Leu Glu Arg Gly Asp 85 90 95 Thr Ile Lys Leu Pro Ala Gly Thr Ile Ala Tyr Leu Ala Asn Arg Asp 100 105 110 Asp Asn Glu Asp Leu Arg Val Leu Asp Leu Ala Ile Pro Val Asn Arg 115 120 125 Pro Gly Gln Leu Gln Ser Phe Leu Leu Ser Gly Thr Gln Asn Gln Pro 130 135 140 Ser Phe Leu Ser Gly Phe Ser Lys Asn Ile Leu Glu Ala Ala Phe Asn 145 150 155 160 Thr Glu Tyr Glu Glu Ile Glu Lys Val Leu Leu Glu Glu Gln Glu Gln 165 170 175 Lys Ser Gln His Arg Arg Ser Leu Arg Asp Lys Arg Gln Glu Ile Thr 180 185 190

Asn Glu Asp Val Ile Val Lys Val Ser Arg Glu Gln Ile Glu Glu Leu 195 200 205 Ser Lys Asn Ala Lys Ser Ser Ser Lys Lys Ser Val Ser Ser Glu Ser 210 215 220 Glu Pro Phe Asn Leu Arg Ser Arg Asn Pro Ile Tyr Ser Asn Lys Phe 225 230 235 240 Gly Lys Phe Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln Leu Gln Asp 245 250 255 Leu Asp Ile Phe Val Asn Ser Val Glu Ile Lys Glu Gly Ser Leu Leu 260 265 270 Leu Pro Asn Tyr Asn Ser Arg Ala Ile Val Ile Val Thr Val Asn Glu 275 280 285 Gly Lys Gly Asp Phe Glu Leu Val Gly Gln Arg Asn Glu Asn Gln Gln 290 295 300 Glu Gln Arg Glu Glu Asn Asp Glu Glu Glu Gly Gln Glu Glu Glu Thr 305 310 315 320 Thr Lys Gln Val Gln Arg Tyr Arg Ala Arg Leu Ser Pro Gly Asp Val 325 330 335 Leu Val Ile Pro Ala Gly His Pro Val Ala Ile Asn Ala Ser Ser Asp 340 345 350 Leu Asn Leu Ile Gly Phe Gly Ile Asn Ala Lys Asn Asn Gln Arg Asn 355 360 365 Phe Leu Ala Gly Glu Glu Asp Asn Val Ile Ser Gln Ile Gln Arg Pro 370 375 380 Val Lys Glu Leu Ala Phe Pro Gly Ser Ser Arg Glu Val Asp Arg Leu 385 390 395 400 Leu Thr Asn Gln Lys Gln Ser His Phe Ala Asn Ala Gln Pro Leu Gln 405 410 415 Ile Glu <210> SEQ ID NO 225 <211> LENGTH: 415 <212> TYPE: PRT <213> ORGANISM: Lens culinaris <400> SEQUENCE: 225 Ser Arg Ser Asp Gln Glu Asn Pro Phe Ile Phe Lys Ser Asn Arg Phe 1 5 10 15 Gln Thr Ile Tyr Glu Asn Glu Asn Gly His Ile Arg Leu Leu Gln Lys 20 25 30 Phe Asp Lys Arg Ser Lys Ile Phe Glu Asn Leu Gln Asn Tyr Arg Leu 35 40 45 Leu Glu Tyr Lys Ser Lys Pro His Thr Leu Phe Leu Pro Gln Tyr Thr 50 55 60 Asp Ala Asp Phe Ile Leu Val Val Leu Ser Gly Lys Ala Val Leu Thr 65 70 75 80 Val Leu Asn Ser Asn Asp Arg Asn Ser Phe Asn Leu Glu Arg Gly Asp 85 90 95 Thr Ile Lys Leu Pro Ala Gly Thr Ile Ala Tyr Leu Ala Asn Arg Asp 100 105 110 Asp Asn Glu Asp Leu Arg Val Leu Asp Leu Ala Ile Pro Val Asn Asn 115 120 125 Pro Gly Gln Leu Glu Ser Phe Leu Leu Ser Gly Thr Gln Asn Gln Pro 130 135 140 Ser Phe Leu Ser Gly Phe Asn Lys Ser Ile Leu Glu Ala Ala Phe Asn 145 150 155 160 Thr Asp Tyr Glu Glu Ile Glu Lys Val Leu Leu Glu Asp Gln Glu Gln 165 170 175 Glu Pro Gln His Arg Arg Ser Leu Arg Asp Arg Arg Gln Glu Ile Asn 180 185 190 Lys Glu Asn Val Ile Val Lys Val Ser Arg Glu Gln Ile Lys Glu Leu 195 200 205 Ser Lys Asn Ala Lys Ser Ser Ser Lys Lys Ser Val Ser Ser Glu Ser 210 215 220 Glu Pro Phe Asn Leu Arg Ser Arg Asn Pro Ile Tyr Ser Asn Lys Phe 225 230 235 240 Gly Lys Phe Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln Leu Gln Asp 245 250 255 Leu Asp Ile Phe Val Asn Ser Val Glu Ile Lys Glu Gly Ser Leu Leu 260 265 270 Leu Pro Asn Tyr Asn Ser Arg Ala Ile Val Ile Val Thr Val Asn Glu 275 280 285 Gly Lys Gly Tyr Phe Glu Leu Val Gly Gln Arg Asn Glu Asn Gln Arg 290 295 300 Glu Glu Asn Asp Asp Glu Glu Glu Gln Glu Glu Glu Thr Ser Thr Gln 305 310 315 320 Val Gln Arg Tyr Arg Ala Lys Leu Ser Pro Gly Asp Val Phe Val Val 325 330 335 Pro Ala Gly His Pro Val Ala Ile Asn Ala Ser Ser Asp Leu Asn Leu 340 345 350 Ile Gly Phe Gly Ile Asn Ala Lys Asn Asn Gln Arg Asn Phe Leu Ala 355 360 365 Gly Glu Glu Asp Asn Val Ile Ser Gln Ile Gln Arg Pro Val Lys Glu 370 375 380 Leu Ala Phe Pro Gly Ser Ser Arg Glu Val Asp Arg Leu Leu Thr Asn 385 390 395 400 Gln Lys Gln Ser His Phe Ala Asn Ala Gln Pro Leu Gln Ile Glu 405 410 415 <210> SEQ ID NO 226 <211> LENGTH: 463 <212> TYPE: PRT <213> ORGANISM: Vicia narbonensis <400> SEQUENCE: 226 Met Ala Ala Ile Thr Met Lys Val Ser Phe Pro Leu Leu Met Leu Leu 1 5 10 15 Gly Ile Ser Phe Leu Ala Ser Val Cys Val Ser Ser Arg Ser Asp Gln 20 25 30 Glu Asn Pro Phe Ile Phe Lys Ser Asn Lys Phe Gln Thr Leu Phe Glu 35 40 45 Asn Asp Asn Gly His Ile Arg Leu Leu Gln Lys Phe Asp Glu Arg Ser 50 55 60 Lys Ile Leu Glu Asn Leu Gln Asn Tyr Arg Leu Leu Glu Tyr Lys Ser 65 70 75 80 Lys Pro Arg Thr Ile Phe Leu Pro Gln Gln Thr Asn Ala Asp Phe Ile 85 90 95 Leu Val Val Leu Ser Gly Lys Ala Ile Leu Thr Val Leu Lys Pro Asp 100 105 110 Asp Arg Asn Ser Phe Asn Leu Glu Arg Gly Asp Thr Ile Lys Leu Pro 115 120 125 Ala Gly Thr Ile Ala Tyr Leu Val Asn Lys Asp Asp Asn Glu Asp Leu 130 135 140 Arg Val Leu Asp Leu Ala Ile Pro Val Asn Gly Pro Asp Gln Leu Gln 145 150 155 160 Ser Phe Leu Leu Ser Gly Ser Glu Asn Gln Gln Ser Ile Leu Ser Gly 165 170 175 Phe Ser Lys Ser Val Leu Glu Ala Ser Phe Asn Thr Gly Tyr Glu Glu 180 185 190 Ile Glu Lys Val Leu Leu Glu Glu Arg Glu Lys Glu Thr Gln His Arg 195 200 205 Arg Ser Leu Arg Asp Lys Arg Gln His Ser Gln Asp Glu Asp Val Ile 210 215 220 Val Lys Leu Ser Arg Gly Gln Ile Glu Glu Leu Ser Arg Asn Ala Lys 225 230 235 240 Ser Ser Ser Lys Lys Ser Val Ser Ser Glu Ser Glu Pro Phe Asn Leu 245 250 255 Arg Ser Arg Asn Pro Ile Tyr Ser Asn Lys Phe Gly Lys Phe Phe Glu 260 265 270 Ile Thr Pro Glu Lys Asn Pro Gln Leu Gln Asp Leu Asp Val Leu Val 275 280 285 Asn Ser Val Glu Ile Lys Glu Gly Ser Leu Leu Leu Pro His Tyr Asn 290 295 300 Ser Arg Ala Ile Val Ile Val Thr Val Asn Asp Gly Lys Gly Asp Phe 305 310 315 320 Glu Ile Val Gly Gln Arg Asn Glu Asn Arg Gln Gly Gln Arg Lys Glu 325 330 335 Asp Asp Glu Glu Glu Glu Gln Gly Asp Glu Asn Thr Asn Thr Gln Val 340 345 350 Gln Asn Tyr Lys Ala Lys Leu Ser Arg Gly Asp Val Phe Val Ile Pro 355 360 365 Ala Gly His Pro Val Ser Ile Lys Ala Ser Ser Asn Leu Asp Leu Leu 370 375 380 Gly Phe Gly Ile Asn Ala Lys Asn Asn Gln Arg Asn Phe Leu Ala Gly 385 390 395 400 Glu Glu Asp Asn Val Ile Ser Gln Ile Asp Arg Pro Val Lys Glu Leu 405 410 415 Ala Phe Pro Gly Ser Ala Gln Glu Val Asp Arg Leu Leu Glu Asn Gln 420 425 430 Lys Gln Ser His Phe Ala Asn Ala Gln Pro Gln Gln Arg Glu Arg Gly 435 440 445 Ser His Glu Thr Arg Asp His Leu Ser Ser Ile Leu Asp Ala Phe 450 455 460 <210> SEQ ID NO 227 <211> LENGTH: 396 <212> TYPE: PRT <213> ORGANISM: Glycine max <400> SEQUENCE: 227 Gln Tyr Gly His Val Arg Val Leu Gln Arg Phe Asn Lys Arg Ser Gln 1 5 10 15 Gln Leu Gln Asn Leu Arg Asp Tyr Arg Ile Leu Glu Phe Asn Ser Lys 20 25 30 Pro Asn Thr Leu Leu Leu Pro His His Ala Asp Ala Asp Tyr Leu Ile 35 40 45 Val Ile Leu Asn Gly Thr Ala Ile Leu Thr Leu Val Asn Asn Asp Asp 50 55 60 Arg Asp Ser Tyr Asn Leu Gln Ser Gly Asp Ala Leu Arg Val Pro Ala 65 70 75 80 Gly Thr Thr Tyr Tyr Val Val Asn Pro Asp Asn Asp Glu Asn Leu Arg 85 90 95

Met Ile Thr Leu Ala Ile Pro Val Asn Lys Pro Gly Arg Phe Glu Ser 100 105 110 Phe Phe Leu Ser Ser Thr Gln Ala Gln Gln Ser Tyr Leu Gln Gly Phe 115 120 125 Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asp Thr Lys Phe Glu Glu Ile 130 135 140 Asn Lys Val Leu Phe Gly Arg Glu Glu Gly Gln Gln Gln Gly Glu Glu 145 150 155 160 Arg Leu Gln Glu Ser Val Ile Val Glu Ile Ser Lys Lys Gln Ile Arg 165 170 175 Glu Leu Ser Lys His Ala Lys Ser Ser Ser Arg Lys Thr Ile Ser Ser 180 185 190 Glu Asp Lys Pro Phe Asn Leu Arg Ser Arg Asp Pro Ile Tyr Ser Asn 195 200 205 Lys Leu Gly Lys Leu Phe Glu Ile Thr Pro Glu Lys Asn Pro Gln Leu 210 215 220 Arg Asp Leu Asp Val Phe Leu Ser Val Val Asp Met Asn Glu Gly Ala 225 230 235 240 Leu Phe Leu Pro His Phe Asn Ser Lys Ala Ile Val Val Leu Val Ile 245 250 255 Asn Glu Gly Glu Ala Asn Ile Glu Leu Val Gly Ile Lys Glu Gln Gln 260 265 270 Gln Arg Gln Gln Gln Glu Glu Gln Pro Leu Glu Val Arg Lys Tyr Arg 275 280 285 Ala Glu Leu Ser Glu Gln Asp Ile Phe Val Ile Pro Ala Gly Tyr Pro 290 295 300 Val Val Val Asn Ala Thr Ser Asp Leu Asn Phe Phe Ala Phe Gly Ile 305 310 315 320 Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Lys Asp Asn 325 330 335 Val Ile Ser Gln Ile Pro Ser Gln Val Gln Glu Leu Ala Phe Pro Gly 340 345 350 Ser Ala Lys Asp Ile Glu Asn Leu Ile Lys Ser Gln Ser Glu Ser Tyr 355 360 365 Phe Val Asp Ala Gln Pro Gln Gln Lys Glu Glu Gly Asn Lys Gly Arg 370 375 380 Lys Gly Pro Leu Ser Ser Ile Leu Arg Ala Phe Tyr 385 390 395 <210> SEQ ID NO 228 <211> LENGTH: 498 <212> TYPE: PRT <213> ORGANISM: Vicia sativa <400> SEQUENCE: 228 Met Ala Lys Leu Leu Ala Leu Ser Leu Ser Phe Cys Phe Leu Leu Phe 1 5 10 15 Ser Ser Cys Phe Ala Leu Arg Glu Gln Ser Gln Gln Asn Glu Cys Gln 20 25 30 Leu Glu Arg Ile Asn Ala Leu Glu Pro Asp Asn Arg Ile Glu Ser Glu 35 40 45 Gly Gly Leu Ile Glu Thr Trp Asn Pro Asn Asn Arg Gln Phe Arg Cys 50 55 60 Ala Arg Val Ala Leu Ser Arg Ala Thr Leu Gln Arg Asn Ala Leu Arg 65 70 75 80 Arg Pro Tyr Tyr Ser Asn Ala Pro Gln Glu Ile Tyr Ile Gln Gln Gly 85 90 95 Asn Gly Tyr Phe Gly Met Val Phe Pro Gly Cys Pro Glu Thr His Glu 100 105 110 Glu Pro Gln Gln Ser Glu Gln Gly Glu Gly Arg Arg Tyr Arg Asp Ser 115 120 125 His Gln Lys Val Asn Arg Phe Arg Glu Gly Asp Ile Ile Ala Val Pro 130 135 140 Thr Gly Ile Ala Phe Trp Met Tyr Asn Asp Gln Asp Thr Pro Val Ile 145 150 155 160 Ala Ile Ser Leu Thr Asp Thr Gly Ser Ser Asn Asn Gln Leu Asp Gln 165 170 175 Met Pro Arg Arg Phe Tyr Leu Ala Gly Asn Gln Glu Gln Glu Phe Leu 180 185 190 Arg Tyr Gln His Gln Gln Gly Gly Lys Gln Glu Gln Asp Asn Asp Gly 195 200 205 Asn Asn Ile Phe Ser Gly Phe Lys Arg Asp Phe Leu Glu Asp Ala Phe 210 215 220 Asn Val Asn Arg His Ile Val Asp Arg Leu Gln Gly Arg Asn Glu Asp 225 230 235 240 Glu Glu Lys Gly Ala Ile Val Lys Val Lys Gly Gly Leu Ser Ile Ile 245 250 255 Ala Pro Pro Glu Arg Gln Ala Arg His Glu Arg Gly Ser Arg Gln Glu 260 265 270 Glu Asp Glu Asp Glu Lys Glu Glu Arg Gln Pro Ser His His Lys Ser 275 280 285 Arg Arg Asp Glu Asp Glu Asp Asp Lys Glu Lys Arg His Ser Gln Lys 290 295 300 Gly Gln Ser Arg Arg Gln Gly Asp Asn Gly Leu Glu Glu Thr Val Cys 305 310 315 320 Thr Ala Lys Leu Arg Ala Asn Ile Gly Ser Ser Pro Ser Pro Asp Ile 325 330 335 Tyr Asn Pro Gln Ala Gly Arg Ile Lys Thr Val Thr Ser Leu Asp Leu 340 345 350 Pro Val Leu Arg Trp Leu Lys Leu Ser Ala Glu His Gly Ser Leu His 355 360 365 Lys Asn Ala Met Phe Val Pro His Tyr Asn Leu Asn Ala Asn Ser Val 370 375 380 Ile Tyr Ala Leu Lys Gly Arg Ala Arg Leu Gln Val Val Asn Cys Asn 385 390 395 400 Gly Asn Thr Val Phe Asp Gly Glu Leu Glu Ala Gly Arg Ala Leu Thr 405 410 415 Val Pro Gln Asn Tyr Ala Val Ala Ala Lys Ser Leu Ser Glu Arg Phe 420 425 430 Thr Tyr Val Ala Phe Lys Thr Asp Asp Arg Ala Ser Ile Ala Arg Leu 435 440 445 Ala Gly Thr Ser Ser Val Ile Asp Asp Leu Pro Leu Asp Val Val Ala 450 455 460 Ala Thr Phe Asn Met Gln Arg Asn Glu Ala Arg Gln Leu Lys Ser Asn 465 470 475 480 Asn Pro Phe Lys Phe Leu Val Pro Pro Arg Gln Ser Glu Met Arg Ala 485 490 495 Ser Ala <210> SEQ ID NO 229 <211> LENGTH: 531 <212> TYPE: PRT <213> ORGANISM: Medicago truncatula <400> SEQUENCE: 229 Met Ala Lys Leu Leu Ala Leu Ser Leu Ser Leu Cys Phe Leu Leu Phe 1 5 10 15 Ser Gly Cys Phe Ala Ile Arg Glu His Gln Pro His Gln Lys Gln Gln 20 25 30 Pro Gln Gln Asn Glu Cys Gln Leu Glu Gln Leu Asn Ala Leu Glu Pro 35 40 45 Asp Asn Arg Ile Glu Ser Glu Gly Gly Ile Ile Glu Thr Trp Asn Pro 50 55 60 Asn Asn Arg Gln Phe Arg Cys Ala Gly Val Ala Leu Ser Arg Cys Thr 65 70 75 80 Leu Gln Arg Asn Ser Leu Arg Arg Pro Phe Tyr Ser Asn Ala Pro Gln 85 90 95 Glu Ile Phe Ile Gln Gln Gly Ser Gly Tyr Phe Gly Met Val Phe Pro 100 105 110 Gly Cys Pro Glu Thr Phe Glu Glu Pro Gln Glu Ser Glu Gln Arg Glu 115 120 125 Ser Arg Arg Ile Arg Glu Ser Glu Gln Gly Glu Ser Arg Arg Ile Arg 130 135 140 Glu Ser Glu Gln Gly Glu Gly Arg Arg Phe Arg Asp Ser His Gln Lys 145 150 155 160 Val Asn Arg Phe Arg Glu Gly Asp Leu Ile Ala Val Pro Thr Gly Thr 165 170 175 Val Phe Trp Met Tyr Asn Asp Gln Asp Thr Pro Val Ile Ala Val Ser 180 185 190 Leu Ile Asp Thr Gly Ser Phe Gln Asn Gln Leu Asp Glu Met Pro Arg 195 200 205 Arg Phe Tyr Leu Ala Gly Asn Gln Glu Gln Glu Phe Leu Gln Tyr Gln 210 215 220 Gln Gln Gln Val Arg Gly Arg Gly Glu Gln Arg Arg Gly Arg Glu Gln 225 230 235 240 Gln Glu Asn Glu Gly Gly Asn Ile Phe Ser Gly Phe Lys Arg Asp Phe 245 250 255 Leu Glu Asp Ala Leu Asn Val Asn Arg His Ile Val Asp Arg Leu Gln 260 265 270 Gly Arg Asn Glu Asp Glu Glu Lys Gly Ala Ile Val Lys Val Arg Gly 275 280 285 Gly Leu Ser Phe Val Thr Pro Pro Glu Arg Gln Ser Arg His Gln Gly 290 295 300 Gly Ser Ile Ile Glu Glu Asp Glu Asp Glu Glu Asp Glu Trp Arg Arg 305 310 315 320 Pro His His Gln Lys Ser Arg Arg Gly Glu Glu Glu Glu Arg Pro Cys 325 330 335 Arg Arg Gly Gln Lys Cys Glu Arg Ser Asn Gly Leu Glu Glu Thr Ile 340 345 350 Cys Thr Ala Arg Leu Arg Gln Asn Ile Gly Ser Ser Ser Ser Pro Asp 355 360 365 Ile Tyr Asn Pro Glu Ala Gly Arg Ile Lys Thr Val Thr Ser Phe Asp 370 375 380 Leu Pro Ala Leu Arg Trp Leu Arg Leu Ser Ala Glu His Gly Thr Leu 385 390 395 400 His Arg Asn Ala Met Phe Val Pro His Tyr Asn Leu Asn Ala Asn Ser 405 410 415 Ala Ile Tyr Ala Leu Arg Gly Arg Ala Arg Leu Gln Val Val Asn Cys 420 425 430 Asn Gly Asn Thr Val Phe Asp Gly Glu Leu Glu Ala Gly Arg Val Leu 435 440 445

Ile Val Pro Gln Asn Phe Ala Val Ala Ala Lys Ser Met Ser Asp Arg 450 455 460 Phe Gln Tyr Val Ser Phe Lys Thr Asn Asp Asn Ala Ala Ile Ala Arg 465 470 475 480 Leu Ala Gly Thr Gln Ser Thr Leu Ser Gly Val Pro Met Asp Val Leu 485 490 495 Ala Ala Thr Tyr Asn Met Asp Arg Asn Glu Ala Arg Gln Leu Lys Asn 500 505 510 Asn Asn Leu Tyr Lys Phe Leu Val Pro Pro Arg Glu Ser Glu Arg Arg 515 520 525 Ala Ala Ala 530 <210> SEQ ID NO 230 <211> LENGTH: 476 <212> TYPE: PRT <213> ORGANISM: Lotus japonicus <400> SEQUENCE: 230 Met Ala Tyr Lys Leu Phe Ala Leu Ser Leu Ser Phe Cys Phe Leu Leu 1 5 10 15 Phe Gly Gly Cys Phe Ala Ile Arg Gln Gln Ser Gln Gln Gln Asn Glu 20 25 30 Cys Gln Leu Glu Arg Leu Asn Ala Leu Lys Pro Asp Asn Arg Ile Glu 35 40 45 Ser Glu Ala Gly Tyr Ile Glu Thr Trp Asn Pro Thr Asn Asn Gln Phe 50 55 60 Arg Cys Ala Gly Val Ala Leu Ser Arg Cys Thr Leu Arg Arg Asn Gly 65 70 75 80 Leu Lys Arg Pro Ser Tyr Ser Asn Ala Pro Gln Glu Ile Phe Ile Gln 85 90 95 Gln Gly Ser Gly Ile Phe Gly Met Ile Phe Pro Gly Cys Pro Glu Thr 100 105 110 Val Glu Glu Pro Phe Glu Ser Asp Gln Gln Gly Arg Arg Asp Arg His 115 120 125 Gln Lys Val Asn Arg Phe Arg Glu Gly Asp Val Ile Ala Val Pro Pro 130 135 140 Gly Val Val Phe Trp Met Tyr Asn Glu Glu Glu Thr Pro Val Ile Ala 145 150 155 160 Val Ser Leu Ile Asp Thr Gly Ser Tyr Leu Asn Gln Leu Asp Gln Met 165 170 175 Pro Arg Arg Phe Tyr Leu Ser Gly Asn Gln Glu Gln Glu Phe Leu Gln 180 185 190 Tyr Gln Arg Gln Glu Val Arg Gly Arg Glu Glu Glu Asn Gln Gly Gly 195 200 205 Asn Ile Phe Ser Gly Phe Gly Gly Glu Phe Leu Glu Asp Ala Leu Asn 210 215 220 Ile Asp Arg Asn Ile Val His Lys Leu Gln Gly Arg Asp Glu Glu Gln 225 230 235 240 Asp Lys Gly Ala Ile Val Arg Val Lys Gly Gly Leu Ser Val Ile Thr 245 250 255 Pro Pro Glu Arg Gln Ser His Arg Arg Gly Ser Glu Glu Glu Glu Asp 260 265 270 Glu Glu Glu Asp Arg Pro Ser Arg His Gln Ser Arg Gly Gly Ser Arg 275 280 285 Arg Asn Gly Leu Glu Glu Thr Ile Cys Thr Val Arg Leu Arg Met Asn 290 295 300 Ile Gly Lys Ser Ser Ser Pro Asp Ile Phe Asn Pro Gln Ala Gly Arg 305 310 315 320 Ile Lys Thr Ala Thr Gly Phe Asp Phe Pro Ala Leu Arg Phe Leu Lys 325 330 335 Leu Ser Ala Glu His Gly Ser Leu Asn Arg Asn Ala Met Val Val Pro 340 345 350 His Tyr Asn Leu Asn Ala Asn Ser Ile Ile Tyr Ala Leu Arg Gly Arg 355 360 365 Ala Trp Ile Gln Val Val Asn Cys Lys Gly Asn Arg Ile Phe Asp Gly 370 375 380 Glu Leu Glu Glu Gly Gln Val Leu Ile Val Pro Gln Asn Phe Val Val 385 390 395 400 Ala Ala Arg Ser Met Ser Asp Lys Phe Asn Tyr Val Ala Phe Lys Thr 405 410 415 Asn Asp Met Pro Thr Met Ala Lys Leu Ala Gly Ala Thr Ser Glu Ile 420 425 430 Gln Ala Met Pro Leu Glu Val Ile Gln Asn Ala Phe Asn Leu Glu Arg 435 440 445 Glu Gln Ala Lys Gln Val Lys Phe Asn Asn Arg Phe Asn Phe Leu Val 450 455 460 Pro Pro Arg Glu Gln Ser Gln Arg Arg Ala Ser Ala 465 470 475 <210> SEQ ID NO 231 <211> LENGTH: 526 <212> TYPE: PRT <213> ORGANISM: PISUM ABYSSINICUM <400> SEQUENCE: 231 Met Ala Thr Thr Val Glu Ser Arg Phe Pro Leu Leu Leu Phe Pro Gly 1 5 10 15 Ile Ile Phe Leu Ala Ser Val Cys Val Thr Tyr Ala Asn Tyr Asp Glu 20 25 30 Gly Ser Glu Thr Arg Val Pro Gly Gln Arg Glu Arg Gly Arg Gln Glu 35 40 45 Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser Tyr Glu 50 55 60 Lys Glu Glu Asp Glu Glu Glu Lys Gln Lys Tyr Arg Tyr Gln Arg Glu 65 70 75 80 Lys Glu Asp Glu Glu Glu Lys Gln Lys Tyr Arg Tyr Gln Arg Glu Lys 85 90 95 Lys Glu Glu Lys Glu Val Gln Pro Gly Arg Glu Arg Trp Glu Arg Glu 100 105 110 Glu Asp Glu Glu Gln Val Asp Glu Glu Trp Arg Gly Ser Gln Arg Arg 115 120 125 Gln Asp Pro Glu Glu Arg Ala Arg Leu Arg His Arg Glu Glu Arg Thr 130 135 140 Lys Arg Asp Arg Arg His Lys Arg Glu Gly Glu Glu Glu Glu Arg Ser 145 150 155 160 Ser Glu Ser Gln Glu Gln Arg Asn Pro Phe Leu Phe Lys Ser Asn Lys 165 170 175 Phe Leu Thr Leu Phe Glu Asn Glu Asn Gly His Ile Arg Arg Leu Gln 180 185 190 Arg Phe Asp Lys Arg Ser Asp Leu Phe Glu Asn Leu Gln Asn Tyr Arg 195 200 205 Leu Val Glu Tyr Arg Ala Lys Pro His Thr Ile Phe Leu Pro Gln His 210 215 220 Ile Asp Ala Asp Leu Ile Leu Val Val Leu Asn Gly Lys Ala Ile Leu 225 230 235 240 Thr Val Leu Ser Pro Asn Asp Arg Asn Ser Tyr Asn Leu Glu Arg Gly 245 250 255 Asp Thr Ile Lys Ile Pro Ala Gly Thr Thr Ser Tyr Leu Val Asn Gln 260 265 270 Asp Asp Glu Glu Asp Leu Arg Val Val Asp Phe Val Ile Pro Val Asn 275 280 285 Arg Pro Gly Lys Phe Glu Ala Phe Gly Leu Ser Glu Asn Lys Asn Gln 290 295 300 Tyr Leu Arg Gly Phe Ser Lys Asn Ile Leu Glu Ala Ser Leu Asn Thr 305 310 315 320 Lys Tyr Glu Thr Ile Glu Lys Val Leu Leu Glu Glu Gln Glu Lys Lys 325 330 335 Pro Gln Gln Leu Arg Asp Arg Lys Arg Arg Gln Gln Gly Gly Glu Arg 340 345 350 Asp Ala Ile Ile Lys Val Ser Arg Glu Gln Ile Glu Glu Leu Arg Lys 355 360 365 Leu Ala Lys Ser Ser Ser Lys Lys Ser Leu Pro Ser Glu Phe Glu Pro 370 375 380 Phe Asn Leu Arg Ser His Lys Pro Glu Tyr Ser Asn Lys Phe Gly Lys 385 390 395 400 Leu Phe Glu Ile Thr Pro Glu Lys Lys Tyr Pro Gln Leu Gln Asp Leu 405 410 415 Asp Ile Leu Val Ser Cys Val Glu Ile Asn Lys Gly Ala Leu Met Leu 420 425 430 Pro His Tyr Asn Ser Arg Ala Ile Val Val Leu Leu Val Asn Glu Gly 435 440 445 Lys Gly Asn Leu Glu Leu Leu Gly Leu Lys Asn Glu Gln Gln Glu Arg 450 455 460 Glu Asp Arg Lys Glu Arg Asn Asn Glu Val Gln Arg Tyr Glu Ala Arg 465 470 475 480 Leu Ser Pro Gly Asp Val Val Ile Ile Pro Ala Gly His Pro Val Ala 485 490 495 Ile Ser Ala Ser Ser Asn Leu Asn Leu Leu Gly Phe Gly Thr Asn Ala 500 505 510 Glu Asn Asn Gln Arg Asn Phe Leu Ser Gly Ser Asp Asp Asn 515 520 525 <210> SEQ ID NO 232 <211> LENGTH: 541 <212> TYPE: PRT <213> ORGANISM: LATHYRUS ANNUUS <400> SEQUENCE: 232 Met Ala Thr Thr Ile Lys Ser Arg Phe Pro Leu Leu Leu Leu Leu Gly 1 5 10 15 Ile Ile Phe Leu Ala Ser Val Cys Val Thr Trp Ala Asn Tyr Asp Glu 20 25 30 Gly Ser Glu Pro Arg Val Pro Gly Gln Arg Glu Arg Gly Arg Gln Glu 35 40 45 Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser Tyr Glu 50 55 60 Glu Glu Tyr Asp Glu Gly Leu Glu Pro Lys Val Pro Gly Lys Arg Glu 65 70 75 80 Arg Gly Arg Gln Glu Gly Glu Lys Glu Glu Lys Arg His Glu Glu Trp 85 90 95 Arg Pro Ser Tyr Glu Lys Glu Glu Asp Glu Glu Glu Lys Gln Lys Tyr

100 105 110 Asn Tyr Gln Arg Glu Lys Lys Glu His Lys Glu Val Gln Pro Gly Arg 115 120 125 Glu Arg Trp Glu Arg Lys Gln Asp Glu Lys Gln Val Glu Glu Asp Glu 130 135 140 Glu Pro Gly Glu Glu Gln Trp Arg Gly Ser Lys Arg His Glu Asp Pro 145 150 155 160 Glu Glu Arg Ala Arg Leu Arg His Arg Glu Glu Lys Thr Lys Ser Tyr 165 170 175 Val Glu Asp Asn Glu Glu Thr Ser Ser Lys Glu Gly Arg Asn Pro Phe 180 185 190 Leu Phe Lys Ser Asn Lys Phe Leu Thr Leu Phe Glu Asn Glu Asn Gly 195 200 205 His Ile Arg Arg Leu Gln Arg Phe Asp Glu Arg Ser Asp Ile Phe Glu 210 215 220 Asn Leu Gln Asn Tyr Arg Leu Val Glu Tyr Arg Ala Lys Pro His Thr 225 230 235 240 Met Phe Leu Pro Gln His Ile Asp Ala Asp Leu Ile Leu Val Val Leu 245 250 255 Asn Gly Lys Ala Ile Leu Thr Val Leu Ser Pro Asn Asp Arg Asn Ser 260 265 270 Tyr Asn Leu Glu Arg Gly Asp Thr Val Lys Leu Pro Ala Gly Thr Thr 275 280 285 Ser Tyr Leu Val Asn Gln Asp Asp Glu Glu Asp Leu Arg Val Val Asp 290 295 300 Leu Ala Ile Pro Val Asn Arg Pro Gly Lys Phe Glu Ala Phe Gly Leu 305 310 315 320 Ser Ala Asn Lys Asn Gln Tyr Leu Arg Gly Phe Ser Lys Asn Ile Leu 325 330 335 Glu Ala Ser Leu Asn Thr Lys Tyr Glu Thr Ile Glu Lys Val Leu Leu 340 345 350 Glu Glu Arg Arg Asp Gln Lys Gly Arg Gln Gln Gly Gln Glu Thr Asn 355 360 365 Ala Ile Val Lys Val Ser Arg Glu Gln Ile Glu Glu Leu Arg Lys Leu 370 375 380 Ala Lys Ser Ser Ser Lys Lys Ser Leu Leu Ser Glu Ser Glu Pro Leu 385 390 395 400 Asn Leu Arg Ser Gln Asn Pro Lys Tyr Ser Asn Lys Phe Gly Lys Phe 405 410 415 Phe Glu Ile Thr Pro Gln Lys Lys Tyr Pro Gln Leu Gln Asp Leu Asp 420 425 430 Val Ser Ile Ser Cys Val Glu Ile Asn Lys Gly Ala Leu Leu Leu Pro 435 440 445 His Tyr Asn Ser Arg Ser Ile Gly Ile Leu Leu Val Asn Glu Gly Lys 450 455 460 Gly Asn Leu Glu Leu Val Gly Phe Lys Asn Glu Gln Gln Arg Gln Arg 465 470 475 480 Glu Asn Glu Glu Thr Asn Lys Lys Leu Gln Arg Tyr Glu Ala Arg Leu 485 490 495 Ser Ser Gly Asp Val Val Val Ile Pro Glu Gly His Pro Val Ala Ile 500 505 510 Ser Ala Ser Ser Asn Leu Asn Leu Leu Gly Phe Gly Ile Asn Ala Ala 515 520 525 Asn Asn Gln Arg Asn Phe Leu Thr Gly Ser Asp Asp Asn 530 535 540 <210> SEQ ID NO 233 <211> LENGTH: 589 <212> TYPE: PRT <213> ORGANISM: Vicia villosa <400> SEQUENCE: 233 Met Ala Thr Thr Ile Lys Ser Arg Phe Pro Val Leu Leu Leu Leu Gly 1 5 10 15 Ile Ile Phe Leu Thr Ser Val Cys Val Thr Tyr Ala Asn Tyr Asp Glu 20 25 30 Gly Arg Glu Pro Ser Val Pro Gly Gln Arg Glu Arg Gly Arg Gln Glu 35 40 45 Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser Glu Glu 50 55 60 Asp Glu Glu Glu Lys Tyr Lys Tyr Glu Glu Gly Arg Val Pro Gly Gln 65 70 75 80 Arg Glu Arg Gly Arg Gln Glu Gly Glu Lys Glu Glu Lys Arg His Gly 85 90 95 Lys Trp Arg Pro Ser Glu Glu Glu Asp Glu Glu Glu Lys Tyr Arg Tyr 100 105 110 Glu Glu Gly Ser Glu Pro Arg Gly Pro Gly Gln Arg Glu Thr Gly Arg 115 120 125 Gln Glu Gly Glu Lys Glu Lys Gln Arg Pro Glu Arg Glu Pro Ser Tyr 130 135 140 Glu Lys Glu Glu Asp Glu Glu Glu Lys Gln Lys Tyr Gln Tyr His Arg 145 150 155 160 Glu Lys Lys Glu Gln Arg Glu Val Arg Pro Gly Arg Glu Arg Phe Glu 165 170 175 Arg His Glu Asp Glu Glu Gln Trp Arg Gly Ile Gln Arg His Glu Asp 180 185 190 Pro Glu Glu Arg Ala Arg Glu Arg Tyr Arg Ala Glu Ile Ala Lys Arg 195 200 205 Gln Val Glu Glu Glu Arg Glu Glu Arg Asp Ile Pro His Glu Arg Glu 210 215 220 Gln Arg Asn Pro Phe Leu Phe Lys Ser Asn Lys Phe Gln Thr Leu Phe 225 230 235 240 Gln Asn Glu Asn Gly Tyr Ile Arg Arg Leu Gln Arg Phe Asp Lys Arg 245 250 255 Ser Asp Leu Phe Glu Asn Leu Gln Asn Tyr Arg Leu Val Glu Tyr Arg 260 265 270 Ala Lys Pro His Thr Ile Phe Leu Pro Gln His Ile Asp Ala Asp Leu 275 280 285 Ile Ile Val Val Leu Ser Gly Arg Ala Ile Leu Thr Val Leu Ser Pro 290 295 300 Asp Asp Arg Asn Ser Tyr Asn Leu Glu Arg Gly Asp Thr Ile Lys Leu 305 310 315 320 Pro Ala Gly Thr Thr Ser Tyr Leu Val Asn Gln Asp Asp Glu Glu Asp 325 330 335 Leu Arg Val Val Asp Leu Ala Ile Pro Val Asn Arg Pro Gly Lys Val 340 345 350 Glu Ser Phe Leu Leu Ser Gly Asn Lys Asn Gln Tyr Leu Arg Gly Phe 355 360 365 Ser Lys Asn Ile Leu Glu Ala Ser Phe Asn Thr Asn Tyr Glu Thr Ile 370 375 380 Glu Arg Val Leu Leu Glu Glu Gln Asp Lys Glu Ser Gln Gln Ser Ile 385 390 395 400 Gly Gln Lys Arg Arg Ser Gln Arg Gln Glu Thr Asn Ala Leu Val Lys 405 410 415 Val Ser Arg Glu Gln Leu Glu Asp Leu Lys Arg Leu Ala Lys Ser Ser 420 425 430 Ser Gln Glu Gly Leu Ser Ser Gln Phe Glu Pro Ile Asn Leu Arg Ser 435 440 445 Gln Asn Pro Lys Tyr Ser Asn Lys Phe Gly Lys Val Phe Glu Ile Thr 450 455 460 Pro Glu Lys Lys Tyr Pro Gln Leu Gln Asp Leu Asp Leu Phe Val Ser 465 470 475 480 Ser Val Asp Ile Lys Glu Gly Ala Leu Met Leu Pro His Tyr Asn Ser 485 490 495 Arg Ala Ile Val Val Leu Leu Val Asn Glu Gly Arg Gly Asn Leu Glu 500 505 510 Leu Val Gly Leu Lys Asn Glu Gln Gln Glu Gln Arg Glu Lys Glu Asp 515 520 525 Glu Gln Gln Glu Arg Asn Asn Gln Val Gln Arg Tyr Glu Ala Arg Leu 530 535 540 Ser Pro Gly Asp Val Val Ile Ile Pro Ala Gly His Pro Val Ala Val 545 550 555 560 Arg Ala Ser Ser Asp Leu Asn Leu Leu Ala Phe Gly Ile Asn Ala Glu 565 570 575 Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Asp Asp Asn 580 585 <210> SEQ ID NO 234 <211> LENGTH: 463 <212> TYPE: PRT <213> ORGANISM: Medicago truncatula <400> SEQUENCE: 234 Met Ala Ile Lys Ala Pro Phe Gln Leu Leu Met Leu Leu Gly Ile Phe 1 5 10 15 Phe Leu Ala Ser Val Cys Val Ser Ser Arg Asp Asp Arg His Asp Gln 20 25 30 Glu Asn Pro Phe Phe Phe Asn Ala Asn His Phe Gln Thr Leu Phe Glu 35 40 45 Asn Glu Asn Gly His Ile Arg Leu Leu Gln Arg Phe Asp Lys Arg Ser 50 55 60 Lys Ile Phe Glu Asn Leu Gln Asn Tyr Arg Leu Leu Glu Tyr His Ser 65 70 75 80 Lys Pro His Thr Leu Phe Leu Pro Gln His Asn Asp Ala Asp Phe Ile 85 90 95 Leu Ala Val Leu Ser Gly Lys Ala Ile Leu Thr Val Leu Asn Pro Asp 100 105 110 Asn Arg Asn Ser Phe Asn Leu Glu Arg Gly Asp Thr Ile Lys Leu Pro 115 120 125 Ala Gly Ser Ile Ala Tyr Leu Ala Asn Arg Asp Asp Asn Glu Asp Leu 130 135 140 Arg Val Leu Asp Leu Ala Ile Pro Val Asn Arg Pro Gly Lys Phe Gln 145 150 155 160 Ser Phe Ser Leu Ser Gly Ser Gln Asn Gln Gln Ser Phe Phe Ser Gly 165 170 175 Phe Ser Lys Asn Ile Leu Glu Ala Ala Phe Asn Ala Asn Tyr Glu Glu 180 185 190 Ile Glu Arg Val Leu Ile Glu Glu His Glu Gln Glu Pro Gln His Arg 195 200 205 Arg Gly Leu Arg Lys Asp Arg Arg Gln Gln Ser Gln Asp Ser Asn Val 210 215 220

Ile Val Lys Val Ser Arg Glu Gln Ile Glu Glu Leu Ser Arg His Ala 225 230 235 240 Lys Ser Ser Ser Arg Arg Ser Gly Ser Ser Glu Ser Ala Pro Phe Asn 245 250 255 Leu Arg Ser Arg Glu Pro Ile Tyr Ser Asn Glu Phe Gly Asn Phe Phe 260 265 270 Glu Ile Thr Pro Glu Lys Asn Pro Gln Leu Lys Asp Leu Asp Ile Leu 275 280 285 Val Asn Tyr Ala Glu Ile Arg Glu Gly Ser Leu Leu Leu Pro His Phe 290 295 300 Asn Ser Arg Ala Thr Val Ile Val Val Val Asp Glu Gly Lys Gly Glu 305 310 315 320 Phe Glu Leu Val Gly Gln Arg Asn Glu Asn Gln Gln Glu Gln Arg Glu 325 330 335 Glu Asp Glu Gln Gln Glu Glu Glu Arg Ser Gln Gln Val Gln Arg Tyr 340 345 350 Arg Ala Arg Leu Ser Pro Gly Asp Val Tyr Val Ile Pro Ala Gly His 355 360 365 Pro Thr Val Val Ser Ala Ser Ser Asp Leu Ser Leu Leu Gly Phe Gly 370 375 380 Ile Asn Ala Glu Asn Asn Glu Arg Asn Phe Leu Ala Gly Glu Glu Asp 385 390 395 400 Asn Val Ile Ser Gln Ile Glu Arg Pro Val Lys Glu Val Ala Phe Pro 405 410 415 Gly Ser Ala Gln Asp Val Glu Ser Leu Leu Lys Asn Gln Arg Gln Ser 420 425 430 Tyr Phe Ala Asn Ala Gln Pro Gln Gln Arg Glu Arg Glu Glu Gly Arg 435 440 445 Ser Gln Arg Gln Arg Glu Leu Ile Ser Ser Ile Leu Gly Val Phe 450 455 460 <210> SEQ ID NO 235 <211> LENGTH: 499 <212> TYPE: PRT <213> ORGANISM: VICIA PEREGRINA <400> SEQUENCE: 235 Met Ala Thr Thr Phe Lys Ser Arg Phe Ser Leu Leu Leu Leu Leu Gly 1 5 10 15 Ile Ile Phe Leu Ala Phe Val Cys Val Thr Cys Ala Asn Tyr Asp Glu 20 25 30 Gly Ser Glu Pro Arg Val Pro Gly Gln Arg Glu Arg Gly Arg Gln Glu 35 40 45 Gly Glu Lys Glu Glu Gln Ser Arg Glu Arg His Pro Gln Arg Glu Pro 50 55 60 Ser Arg Glu Lys Glu Glu Asp Glu Glu Glu Lys Gln Lys Tyr Asp Glu 65 70 75 80 Gly Thr Glu Pro Arg Val Pro Gly Gln Arg Glu Arg Gly Arg Gln Glu 85 90 95 Gly Glu Lys Glu Glu Gln Arg Arg Glu Arg His Pro Gly Gln Arg Glu 100 105 110 Pro Ser Gln Glu Glu Asp Glu Glu Arg Glu Glu Ser Asp Arg Arg Gln 115 120 125 Glu Gly Ser Ser Lys Ser Glu Glu Gln Arg Asn Pro Phe Leu Phe Lys 130 135 140 Ser Asn Lys Phe Leu Thr Leu Phe Gln Asn Gly Asn Gly His Ile Arg 145 150 155 160 Leu Leu Gln Arg Phe Asp Lys Arg Ser Asp Leu Phe Glu Asn Leu Gln 165 170 175 Asn Tyr Arg Leu Leu Glu Tyr Arg Ala Lys Pro His Thr Ile Phe Leu 180 185 190 Pro Gln His Ile Asp Ala Asp Leu Ile Leu Val Val Leu Ser Gly Arg 195 200 205 Ala Ile Leu Thr Val Leu Ser Pro Asp Asp Arg Asn Ser Tyr Asn Leu 210 215 220 Glu Arg Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr Thr Ser Tyr Pro 225 230 235 240 Leu Asn Gln Asp Asp Glu Glu Asp Leu Arg Val Val Asp Leu Ala Ile 245 250 255 Ser Val Asn Arg Pro Gly Lys Val Glu Ser Phe Asn Leu Ser Gly Asn 260 265 270 Lys Asn Gln Tyr Leu Arg Gly Phe Ser Glu Asn Ile Leu Glu Ala Ser 275 280 285 Phe Asn Thr Lys Tyr Glu Thr Ile Glu Lys Val Leu Leu Glu Glu Gln 290 295 300 Asp Lys Glu Ser Gln Gln Pro Arg Gly Gln Arg Leu Gln Arg Gln Glu 305 310 315 320 Thr Asn Ala Leu Val Lys Val Ser Arg Glu Gln Val Glu Glu Leu Lys 325 330 335 Arg Leu Ala Arg Thr Ser Ser Lys Lys Gly Val Ser Ser Glu Phe Glu 340 345 350 Pro Phe Asn Leu Arg Ser His Gly Pro Lys Tyr Ser Asn Lys Phe Gly 355 360 365 Lys Phe Phe Glu Ile Thr Pro Glu Lys Lys Tyr Pro Gln Leu Gln Asp 370 375 380 Leu Asp Ile Ser Val Ser Ser Val Glu Ile Asn Glu Gly Ala Leu Phe 385 390 395 400 Leu Pro His Tyr Asn Ser Arg Ala Ile Val Val Val Leu Val Asp Glu 405 410 415 Gly Lys Gly Asn Leu Glu Leu Val Gly Phe Lys Asn Glu Gln Gln Glu 420 425 430 Gln Arg Glu Lys Glu Asp Glu Gln Glu Glu Arg Asn Lys Gln Val Gln 435 440 445 Arg Tyr Glu Ala Lys Leu Ser Pro Gly Asp Val Val Ile Ile Pro Ala 450 455 460 Gly His Pro Val Ala Val Ser Ala Ser Ser Asn Leu Asn Leu Leu Gly 465 470 475 480 Phe Gly Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Thr Gly Ser 485 490 495 Asp Asp Asn <210> SEQ ID NO 236 <211> LENGTH: 515 <212> TYPE: PRT <213> ORGANISM: VICIA LUTEA <400> SEQUENCE: 236 Met Ala Thr Thr Ile Lys Leu Arg Phe Pro Leu Leu Leu Leu Leu Gly 1 5 10 15 Val Ile Leu Leu Ala Ser Val Cys Val Thr Cys Ala Asn Tyr Asp Glu 20 25 30 Gly Ser Glu Pro Arg Val Pro Gly Arg Pro Glu Gly Glu Lys Glu Glu 35 40 45 Lys His Arg Gly Lys Leu Arg Pro Ser Tyr Glu Lys Glu Glu Asp Glu 50 55 60 Gly Glu Lys Gln Arg Tyr His Tyr Glu Lys Lys Glu Gln Lys Glu Ala 65 70 75 80 Gln Pro Arg Arg Glu Lys Lys Glu Gln Lys Glu Glu Glu Lys Gln Val 85 90 95 Glu Glu Glu Ser Arg Glu Ser Gln Arg Tyr Glu Asp Pro Gly Glu Arg 100 105 110 Ala Arg Glu Arg Tyr Arg Ala Glu Ile Ile Lys Arg Gln Val Glu Lys 115 120 125 Glu Arg Glu Glu Arg Asp Arg Arg His Gln Arg Glu Gly Glu Glu Glu 130 135 140 Glu Gly Ser Ser Lys Ser Arg Asn Pro Phe Leu Phe Lys Ser Asn Asn 145 150 155 160 Phe Leu Thr Leu Phe Glu Asn Glu Asn Gly His Ile Arg Leu Leu Gln 165 170 175 Arg Phe Asp Lys Arg Ser Asp Leu Phe Glu Asn Leu Gln Asn Tyr Arg 180 185 190 Leu Val Glu Tyr Arg Ala Lys Pro His Thr Ile Phe Leu Pro Gln His 195 200 205 Ile Asp Ala Asp Leu Ile Leu Val Val Leu Ser Gly Lys Ala Ile Leu 210 215 220 Thr Val Leu Ser Pro Asn Asn Arg Asn Ser Tyr Asn Leu Lys Arg Gly 225 230 235 240 Asp Thr Ile Lys Leu Pro Ala Gly Thr Thr Ser Tyr Leu Leu Asn Ser 245 250 255 Asp Asp Glu Glu Asp Leu Arg Met Val Asp Leu Ala Ile Ser Val Asn 260 265 270 Arg Pro Gly Lys Val Glu Ser Phe Asn Leu Ser Gly Asn Lys Asn Gln 275 280 285 Tyr Leu Arg Gly Phe Ser Lys Asn Ile Leu Glu Ala Ser Phe Asn Thr 290 295 300 Lys Tyr Glu Thr Ile Glu Lys Val Leu Leu Glu Glu Gln Asp Lys Glu 305 310 315 320 Ser Gln Gln Ser Ile Gly Gln Lys Arg Ile Ser Gln Arg Gln Glu Thr 325 330 335 Asn Ala Leu Val Lys Val Ser Arg Glu Gln Ile Glu Glu Pro Lys Arg 340 345 350 Leu Ala Arg Ser Ser Ser Arg Lys Gly Val Ser Ser Glu Phe Glu Pro 355 360 365 Ile Asn Leu Arg Ser Gln Arg Pro Lys Tyr Ser Asn Lys Phe Gly Lys 370 375 380 Phe Tyr Glu Ile Ser Pro Glu Lys Lys Tyr Pro Gln Leu Gln Asp Leu 385 390 395 400 Asp Val Ser Val Ser Ser Val Glu Ile Asn Glu Gly Ala Leu Leu Leu 405 410 415 Pro His Tyr Asn Ser Arg Ala Ile Val Thr Val Leu Val Asn Glu Gly 420 425 430 Lys Gly Asn Leu Glu Leu Ile Gly Phe Gln Asn Glu Gln Gln Gly Gln 435 440 445 Arg Glu Lys Glu Asp Glu Gln Gln His Glu Arg Asn Lys Gln Val Gln 450 455 460 Arg Tyr Asp Ala Arg Leu Ser Ser Gly Asp Val Val Ile Ile Pro Ala 465 470 475 480 Gly His Pro Val Ala Val Ser Ala Ser Ser Asn Leu Asp Leu Leu Gly 485 490 495 Phe Gly Ile Asn Ala Glu Asn Ser Gln Arg Asn Phe Leu Thr Gly Ser

500 505 510 Asp Asp Asn 515 <210> SEQ ID NO 237 <211> LENGTH: 494 <212> TYPE: PRT <213> ORGANISM: Oryza brachyantha <400> SEQUENCE: 237 Met Ala Thr Thr Thr Phe Ser Arg Phe Ser Ile Tyr Phe Cys Val Leu 1 5 10 15 Leu Leu Cys His Gly Ser Met Ala Gln Leu Phe Ser Pro Thr Leu Asn 20 25 30 Pro Trp His Ser Ser Arg Arg Gly Gly Ser Arg Asp Cys Arg Phe Asp 35 40 45 Arg Leu Gln Ala Phe Glu Pro Leu Arg Arg Val Arg Ser Glu Ala Gly 50 55 60 Val Thr Glu Tyr Phe Asp Glu Arg Asn Glu Gln Phe Gln Cys Thr Gly 65 70 75 80 Thr Phe Val Ile Arg Arg Val Ile Glu Pro Gln Gly Leu Leu Val Pro 85 90 95 Arg Tyr Thr Asn Thr Pro Gly Val Val Tyr Ile Met Gln Gly Arg Gly 100 105 110 Ser Met Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Tyr Gln Gln Gln 115 120 125 Phe Gln Gln Phe Leu Pro Glu Gly Gln Ser Gln Ser Gln Lys Phe Arg 130 135 140 Asp Glu His Gln Lys Ile His Gln Phe Arg Gln Gly Asp Ile Val Ala 145 150 155 160 Leu Pro Ala Gly Val Ala His Trp Phe Tyr Asn Glu Gly Asp Thr Pro 165 170 175 Val Val Ala Leu Tyr Val Phe Asp Ile Asn Asn Ser Ala Asn Gln Leu 180 185 190 Glu Pro Arg Gln Lys Asp Phe Leu Leu Ala Gly Asn Asn Asn Arg Glu 195 200 205 Gln Gln Val Tyr Gly Arg Ser Ile Glu Lys His Ser Gly Gln Asn Ile 210 215 220 Phe Ser Gly Phe Asn His Glu Leu Leu Ser Glu Ala Leu Gly Ile Ser 225 230 235 240 Thr Leu Ala Ala Lys Arg Leu Gln Gly Gln Asn Asp His Arg Gly Glu 245 250 255 Ile Ile Arg Val Arg Asn Gly Leu Gln Leu Leu Lys Pro Thr Phe Thr 260 265 270 Gln Gln Gln Glu Gln Ala Gln Ser Gln Tyr Gln Val Gln Tyr Ser Glu 275 280 285 Lys Gln Gln Glu Ser Thr Arg Cys Asn Gly Leu Asp Glu Asn Phe Cys 290 295 300 Thr Ile Asn Ala Arg Leu Asn Ile Glu Asn Pro Ser Arg Ala Asp Thr 305 310 315 320 Tyr Asn Pro Arg Ala Gly Arg Ile Thr His Leu Asn Asn Gln Lys Phe 325 330 335 Pro Ile Leu Asn Leu Val Gln Met Ser Ala Thr Arg Val Asn Leu Tyr 340 345 350 Gln Asn Ala Ile Leu Ser Pro Tyr Trp Asn Val Asn Ala His Ser Leu 355 360 365 Val Tyr Met Val Gln Gly His Ala Arg Val Gln Val Val Ser Asn Leu 370 375 380 Gly Lys Thr Val Phe Asn Ser Val Leu Arg Pro Gly Gln Leu Leu Ile 385 390 395 400 Ile Pro Gln His Tyr Val Val Leu Lys Lys Ala Glu Arg Glu Gly Cys 405 410 415 Gln Tyr Ile Ala Phe Lys Thr Asn Ala Asn Ser Ile Val Ser Gln Leu 420 425 430 Ala Gly Lys Asn Ser Ile Leu Arg Ala Met Pro Val Asp Val Val Ala 435 440 445 Asn Ala Tyr Arg Ile Ser Arg Glu Gln Ala Arg Asp Leu Lys Asn Asn 450 455 460 Arg Gly Glu Glu Leu Gly Ala Phe Thr Pro Lys Phe Glu Gln Gln Ser 465 470 475 480 Tyr Pro Gly Leu Ser Asn Glu Ser Glu Ser Glu Ala Ser Glu 485 490 <210> SEQ ID NO 238 <211> LENGTH: 515 <212> TYPE: PRT <213> ORGANISM: Avena sativa <400> SEQUENCE: 238 Met Ala Thr Thr Ser Phe Pro Ser Val Leu Phe Tyr Ser Cys Ile Phe 1 5 10 15 Leu Leu Tyr Asn Gly Ser Met Ala Gln Leu Phe Gly Gln Ser Phe Thr 20 25 30 Pro Trp Gln Ser Ser Arg Gln Gly Gly Leu Lys Gly Cys Lys Phe Asp 35 40 45 Arg Leu Gln Ala Phe Glu Pro Leu Arg Gln Val Arg Ser Gln Ala Gly 50 55 60 Val Thr Glu Tyr Phe Asp Glu Gln Asn Glu Gln Phe Arg Cys Thr Gly 65 70 75 80 Val Phe Val Ile Arg Arg Val Ile Glu Pro Gln Gly Leu Leu Leu Pro 85 90 95 Gln Tyr His Asn Ala Pro Gly Leu Val Tyr Ile Leu Gln Gly Arg Gly 100 105 110 Tyr Thr Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Phe Gln Gln Gln 115 120 125 Phe Gln Pro Phe Asp Gln Ala Gln Asp Gln Ser Gln Ser His Leu Lys 130 135 140 Asp Glu His Gln Arg Val His Arg Phe Lys Gln Gly Asp Val Ile Ala 145 150 155 160 Leu Pro Ala Gly Ile Val His Trp Gly Tyr Asn Asp Gly Asp Ala Pro 165 170 175 Val Val Ala Ile Tyr Val Phe Asp Val Asn Asn Asn Ala Asn Gln Leu 180 185 190 Glu Pro Arg Gln Lys Glu Phe Leu Leu Ala Gly Asn Asn Lys Glu Asp 195 200 205 Gln Gln Phe Gly Gln Asn Ile Phe Ser Gly Phe Asn Ile Gln Leu Leu 210 215 220 Ser Glu Ala Leu Gly Ile Ser Gln Gln Ala Ala Gln Arg Ile Gln Ser 225 230 235 240 Gln Lys Glu Gln Arg Gly Glu Ile Ile Arg Val Thr Gln Ala Leu Gln 245 250 255 Phe Leu Lys Pro Thr Met Ser Gln Gln Glu Leu Val Glu His Gln Ala 260 265 270 Tyr Gln Pro Ile Gln Ser Gln Glu Gly Gln Ser Thr Gln Tyr Gln Val 275 280 285 Gly Gln Ser Thr Gln Tyr Gln Glu Gly Gln Ser Thr Gln Tyr Gln Ala 290 295 300 Gly Gln Ser Gln Asp Arg Ser Phe Asn Gly Leu Glu Glu Asn Phe Cys 305 310 315 320 Ser Leu Glu Ala Arg Gln Asn Ile Gly Asn Pro Lys Arg Ala Asp Thr 325 330 335 His Asn Pro Arg Ala Gly Arg Ile Thr Arg Leu His Gly Gln Asn Phe 340 345 350 Pro Ile Leu Asn Leu Val Gln Met Ser Ala Thr Arg Val Asn Leu Tyr 355 360 365 Gln Asn Ala Ile Leu Ser Pro Phe Trp Asn Ile Asn Ala His Ser Val 370 375 380 Val Tyr Met Ile Gln Gly His Ala Gln Val Gln Val Val Asn Asn Asn 385 390 395 400 Gly Gln Thr Val Phe Asn Asp Arg Leu Arg Gln Gly Gln Leu Leu Ile 405 410 415 Val Pro Gln His Tyr Val Val Leu Lys Lys Ala Glu Arg Glu Gly Cys 420 425 430 Gln Tyr Ile Ser Phe Lys Thr Asn Pro Asn Ser Met Val Ser His Ile 435 440 445 Ala Gly Lys Ser Ser Ile Leu Arg Ala Leu Pro Val Asp Val Leu Ala 450 455 460 Asn Ala Tyr Arg Ile Ser Arg Gln Glu Ala Arg Asn Leu Lys Asn Asn 465 470 475 480 Arg Gly Gln Glu Ser Gly Val Phe Thr Pro Lys Phe Thr Gln Thr Ser 485 490 495 Phe Gln Pro Tyr Pro Glu Gly Glu Asp Glu Ser Ser Leu Thr Asn Lys 500 505 510 Ala Ser Glu 515 <210> SEQ ID NO 239 <211> LENGTH: 493 <212> TYPE: PRT <213> ORGANISM: Brachypodium distachyon <400> SEQUENCE: 239 Met Ala His Thr Ser Phe Ser Ser Val Leu Ser Tyr Phe Cys Ile Phe 1 5 10 15 Leu Leu Phe His Gly Ser Met Ala Gln Val Pro Gly Gln Gly Ser Thr 20 25 30 Trp Gln Ser Pro Arg Gln Gly Gly Ser Arg Glu Cys Ser Phe Asp Arg 35 40 45 Leu Gln Thr Ile Glu Pro Leu Thr Gln Val Arg Ser Gln Ala Gly Leu 50 55 60 Thr Glu Tyr Phe Asp Glu Gln Asn Glu Gln Phe Arg Cys Ala Gly Val 65 70 75 80 Ser Val Ile Arg Arg Val Ile Glu Pro Arg Gly Leu Leu Leu Pro Arg 85 90 95 Tyr His Asn Thr Pro Gly Leu Val Tyr Ile Leu Glu Gly Ser Gly Phe 100 105 110 Val Gly Leu Ala Phe Pro Gly Cys Pro Glu Thr Phe Leu Glu Gln Phe 115 120 125 Gln Gln Ser Arg Gln Thr Gln Ser Thr Leu Gly Gln Ser Gln Cys Gln 130 135 140 Ser Gln Ser Gln Lys Leu Gly Asp Val His Gln Arg Val His Gln Phe 145 150 155 160

Thr Gln Gly Asp Val Val Ala Leu Pro Ala Gly Val Ala His Trp Phe 165 170 175 Tyr Asn Gly Gly Asp Ala Pro Val Val Ala Val Tyr Val Phe Asp Val 180 185 190 Asn Asn Asn Ala Asn Gln Leu Glu Pro Arg Gln Lys Glu Phe Leu Leu 195 200 205 Ala Gly Asn Tyr Asn Gly Val Leu Gln Ser Gly Arg Asn Ile Leu Asn 210 215 220 Gly Leu Asn Ala Gln Leu Leu Ser Gln Ala Phe Gly Ile Asn Glu Gln 225 230 235 240 Thr Ser Arg Ile Ile Gln Asn Gln Asn Asp Gly Arg Gly Glu Ile Val 245 250 255 Arg Val Glu Tyr Gly Leu Gln Phe Leu Thr Pro Val Val Thr Gln Gln 260 265 270 Gln Gln Lys Gln Pro Phe Leu Pro Ile Glu Pro Gln Glu Gly Gln Ser 275 280 285 Ser Arg Asn Gly Leu Glu Glu Asn Phe Cys Ser Leu Glu Pro Arg Gln 290 295 300 Asn Ile Glu Asp Pro Asn Arg Ala Asp Thr Tyr Asn Pro Arg Ala Gly 305 310 315 320 Ser Ile Ala Arg Leu Asn Gly Gln Asn Phe Pro Ile Leu Asn Leu Val 325 330 335 Gln Met Ser Ala Thr Arg Val Asn Leu Gln Lys Asn Ala Ile Val Ser 340 345 350 Pro Phe Trp Asn Ile Asn Ala His Ser Val Val Tyr Val Ile Gln Gly 355 360 365 Gln Ala Ser Val Gln Val Val Asn Asn Gln Gly Arg Asn Val Phe Asn 370 375 380 Gly Leu Leu Arg Arg Gly Gln Leu Leu Ile Ile Pro Gln Asn Tyr Val 385 390 395 400 Val Leu Lys Lys Ala Glu Ser Glu Gly Tyr Gln Tyr Ile Ala Phe Lys 405 410 415 Thr Asn Ala Asn Ser Met Val Ser His Ile Ala Gly Lys Asn Ser Ile 420 425 430 Leu Arg Ala Leu Pro Val Asp Val Ile Ala Asn Ala Tyr Arg Ile Ser 435 440 445 Arg Gln Glu Ala Gln Asn Leu Lys Asn Asn Arg Gly Glu Glu Ile Gly 450 455 460 Val Leu Thr Pro Asn Phe Pro Gln Ser Ser Cys Gln Ser Tyr Pro Ile 465 470 475 480 Gly Asp Val Asp Ser Ser Ser Thr Pro Lys Ala Gln Glu 485 490 <210> SEQ ID NO 240 <211> LENGTH: 489 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 240 Met Ala Gln Phe Ser Phe Gly Gly Ser Pro Leu Gln Ser Pro Arg Gly 1 5 10 15 Phe Arg Gly Asp Gln Asp Ser Arg His Gln Cys Arg Phe Glu His Leu 20 25 30 Thr Ala Leu Glu Ala Thr His Gln Gln Arg Ser Glu Ala Gly Phe Thr 35 40 45 Glu Tyr Tyr Asn Ile Glu Ala Arg Asn Glu Phe Arg Cys Ala Gly Val 50 55 60 Ser Val Arg Arg Leu Val Val Glu Ser Lys Gly Leu Val Leu Pro Met 65 70 75 80 Tyr Ala Asn Ala His Lys Leu Val Tyr Ile Val Gln Gly Arg Gly Val 85 90 95 Phe Gly Met Ala Leu Pro Gly Cys Pro Glu Thr Phe Gln Ser Val Arg 100 105 110 Ser Pro Phe Glu Gln Glu Val Ala Thr Ala Gly Glu Ala Gln Ser Ser 115 120 125 Ile Gln Lys Met Arg Asp Glu His Gln Gln Leu His Gln Phe His Gln 130 135 140 Gly Asp Val Ile Ala Val Pro Ala Gly Val Ala His Trp Leu Tyr Asn 145 150 155 160 Asn Gly Asp Ser Pro Val Val Ala Phe Thr Val Ile Asp Thr Ser Asn 165 170 175 Asn Ala Asn Gln Leu Asp Pro Lys Arg Arg Glu Phe Phe Leu Ala Gly 180 185 190 Lys Pro Arg Ser Ser Trp Gln Gln Gln Ser Tyr Ser Tyr Gln Thr Glu 195 200 205 Gln Leu Ser Arg Asn Gln Asn Ile Phe Ala Gly Phe Ser Pro Asp Leu 210 215 220 Leu Ser Glu Ala Leu Ser Val Ser Lys Gln Thr Val Leu Arg Leu Gln 225 230 235 240 Gly Leu Ser Asp Pro Arg Gly Ala Ile Ile Arg Val Glu Asn Gly Leu 245 250 255 Gln Ala Leu Gln Pro Ser Leu Gln Val Glu Pro Val Lys Glu Glu Gln 260 265 270 Thr Gln Ala Tyr Leu Pro Thr Lys Gln Leu Gln Pro Thr Trp Leu Arg 275 280 285 Ser Gly Gly Ala Cys Gly Gln Gln Asn Val Leu Asp Glu Ile Met Cys 290 295 300 Ala Phe Lys Leu Arg Lys Asn Ile Asp Asn Pro Gln Ser Ser Asp Ile 305 310 315 320 Phe Asn Pro His Gly Gly Arg Ile Thr Arg Ala Asn Ser Gln Asn Phe 325 330 335 Pro Ile Leu Asn Ile Ile Gln Met Ser Ala Thr Arg Ile Val Leu Gln 340 345 350 Asn Asn Ala Leu Leu Thr Pro His Trp Thr Val Asn Ala His Thr Val 355 360 365 Met Tyr Val Thr Ala Gly Gln Gly His Ile Gln Val Val Asp His Arg 370 375 380 Gly Arg Ser Val Phe Asp Gly Glu Leu His Gln Gln Gln Ile Leu Leu 385 390 395 400 Ile Pro Gln Asn Phe Ala Val Val Val Lys Ala Arg Arg Glu Gly Phe 405 410 415 Ala Trp Val Ser Phe Lys Thr Asn His Asn Ala Val Asp Ser Gln Ile 420 425 430 Ala Gly Lys Ala Ser Ile Leu Arg Ala Leu Pro Val Asp Val Val Ala 435 440 445 Asn Ala Tyr Arg Leu Ser Arg Glu Asp Ser Arg His Val Lys Phe Asn 450 455 460 Arg Gly Asp Glu Met Ala Val Phe Ala Pro Arg Arg Gly Pro Gln Gln 465 470 475 480 Tyr Ala Glu Trp Gln Ile Asn Glu Lys 485 <210> SEQ ID NO 241 <211> LENGTH: 489 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 241 Met Ala Gln Phe Ser Phe Gly Gly Ser Pro Leu Gln Ser Pro Arg Gly 1 5 10 15 Phe Arg Gly Asp Gln Asp Ser Arg His Gln Cys Arg Phe Glu His Leu 20 25 30 Thr Ala Leu Glu Ala Thr His Gln Gln Arg Ser Glu Ala Gly Phe Thr 35 40 45 Glu Tyr Tyr Asn Ile Glu Ala Arg Asn Glu Phe Arg Cys Ala Gly Val 50 55 60 Ser Val Arg Arg Leu Val Val Glu Ser Lys Gly Leu Val Leu Pro Met 65 70 75 80 Tyr Ala Asn Ala His Lys Leu Val Tyr Ile Val Gln Gly Arg Gly Val 85 90 95 Phe Gly Met Ala Leu Pro Gly Cys Pro Glu Thr Phe Gln Ser Val Arg 100 105 110 Ser Pro Phe Glu Gln Glu Val Ala Thr Ala Gly Glu Ala Gln Ser Ser 115 120 125 Met Gln Lys Met Arg Asp Glu His Gln Gln Leu His Gln Phe His Gln 130 135 140 Gly Asp Val Ile Ala Val Pro Ala Gly Val Ala His Trp Leu Tyr Asn 145 150 155 160 Asn Gly Asp Ser Pro Val Val Ala Phe Thr Val Ile Asp Thr Ser Asn 165 170 175 Asn Ala Asn Gln Leu Asp Pro Lys Arg Arg Glu Phe Phe Leu Ala Gly 180 185 190 Lys Pro Arg Ser Ser Trp Gln Gln Gln Ser Tyr Ser Tyr Gln Thr Glu 195 200 205 Gln Leu Ser Arg Asn Gln Asn Ile Phe Ala Gly Phe Asn Pro Asp Leu 210 215 220 Leu Ser Glu Ala Leu Ser Val Ser Lys Gln Thr Val Leu Arg Leu Gln 225 230 235 240 Gly Leu Ser Asp Pro Arg Gly Ala Ile Ile Arg Val Glu Asn Gly Leu 245 250 255 Gln Ala Leu Gln Pro Ser Leu Gln Val Glu Pro Val Lys Glu Glu Gln 260 265 270 Thr Gln Ala Tyr Leu Pro Thr Lys Gln Leu Gln Pro Thr Trp Ser Arg 275 280 285 Ser Gly Gly Ala Cys Gly Gln Gln Asn Gly Leu Asp Glu Ile Met Cys 290 295 300 Ala Phe Lys Leu Arg Lys Asn Ile Asp Asn Pro Gln Ser Ser Asp Ile 305 310 315 320 Phe Asn Pro His Gly Gly Arg Ile Thr Arg Ala Asn Ser Gln Asn Phe 325 330 335 Pro Ile Leu Asn Ile Ile Gln Met Ser Ala Thr Arg Ile Val Leu Gln 340 345 350 Asn Asn Ala Leu Leu Thr Pro His Trp Thr Val Asn Ala His Thr Val 355 360 365 Met Tyr Val Thr Ala Gly Gln Gly Arg Ile Gln Val Val Asp His Arg 370 375 380 Gly Arg Ser Val Phe Asp Gly Glu Leu His Gln Gln Gln Ile Leu Leu 385 390 395 400 Ile Pro Gln Asn Phe Ala Val Val Val Lys Ala Arg Arg Glu Gly Phe 405 410 415 Ala Trp Val Ser Phe Lys Thr Asn His Asn Ala Val Asp Ser Gln Ile

420 425 430 Ala Gly Lys Ala Ser Ile Leu Arg Ala Leu Pro Val Asp Val Val Ala 435 440 445 Asn Ala Tyr Arg Leu Ser Arg Glu Asp Ser Arg Arg Val Lys Phe Asn 450 455 460 Arg Gly Asp Glu Met Ala Val Phe Ala Pro Arg Arg Gly Pro Gln Gln 465 470 475 480 Tyr Ala Glu Trp Gln Ile Asn Glu Lys 485 <210> SEQ ID NO 242 <211> LENGTH: 504 <212> TYPE: PRT <213> ORGANISM: Oryza brachyantha <400> SEQUENCE: 242 Met Val Asp Met Ser Ile Val Val Pro Val Cys Leu Thr Ile Phe Leu 1 5 10 15 Leu Ser Gln Val Cys Ile Ala Gln Val Ser Phe Asp Gly Ser Pro Leu 20 25 30 Tyr Ser Ser Arg Gly Phe Arg Gly Gly Ser Ala Ser Gln Gln Gln Cys 35 40 45 Arg Phe Glu His Leu Ala Ala Leu Glu Val Thr His Gln Glu Lys Ser 50 55 60 Glu Ala Gly Ser Ile Glu Tyr Tyr Asn Thr Glu Ala Arg Asp Glu Phe 65 70 75 80 Arg Cys Ala Arg Val Ser Ala Arg Arg Leu Val Ile Glu Ser Arg Gly 85 90 95 Leu Val Leu Pro Val Tyr Ala Asn Ala His Lys Leu Leu Tyr Ile Val 100 105 110 Gln Gly Arg Gly Val Phe Gly Met Ala Leu Pro Gly Cys Pro Glu Thr 115 120 125 Phe Gln Ser Val Arg Ser Ala Phe Glu Met Ala Thr Gly Asp Ala Glu 130 135 140 Ser Ser Thr Arg Lys Leu Arg Asp Glu His Gln Lys Ile His Gln Phe 145 150 155 160 Arg Gln Gly Asp Val Ile Ala Val Pro Pro Gly Val Ala His Trp Leu 165 170 175 Tyr Asn Asn Gly Asp Ser Pro Val Val Ala Phe Ser Val Ile Asp Phe 180 185 190 Gly Asn Asn Ala Asn Gln Leu Asp Pro Lys Pro Arg Glu Phe Phe Leu 195 200 205 Ala Gly Lys Pro Trp Gly Trp Gln Gln Val Gln Tyr Ser Tyr Gln Ser 210 215 220 Glu Gln Gln Ser Lys His Gln Asn Ile Phe Ala Gly Phe Asn Pro Asp 225 230 235 240 Leu Leu Ala Glu Ala Leu Ser Val Ser Arg Gln Thr Ala Met Arg Leu 245 250 255 Gln Glu Leu Asn Asp Gln Arg Gly Ala Ile Ile Arg Val Glu Gln Gly 260 265 270 Leu Gln Leu Ala Leu Asp Pro Ser Phe Gln Ala Glu Gln Glu Gln Glu 275 280 285 Glu Gln Pro Gln Glu Tyr Leu Ser Ser Gln Gln Gln Gln Pro Thr Trp 290 295 300 Ser Gln Arg Ser Gly Ala Cys Val Gln Asn Asn Gly Leu Asp Glu Ile 305 310 315 320 Met Cys Ala Phe Lys Val Ser Lys Asn Ile Asn Ser Ala Gln Ser Thr 325 330 335 Asp Ile Phe Asn Pro Arg Gly Gly Arg Ile Thr Arg Ala Asn Ser Gln 340 345 350 Asn Phe Pro Val Leu Asn Ile Ile Gln Met Ser Ala Thr Arg Thr Val 355 360 365 Leu Gln Asn Asn Ala Leu Leu Thr Pro His Trp Thr Val Asn Ala His 370 375 380 Thr Val Met Tyr Val Thr Ala Gly Gln Gly Arg Ile Gln Val Val Asp 385 390 395 400 His Arg Gly Arg Thr Val Phe Asp Gly Glu Leu Arg Gln Gln Gln Ile 405 410 415 Leu Leu Ile Pro Gln Asn Phe Ala Val Ala Val Lys Ala Arg His Glu 420 425 430 Gly Phe Ser Trp Val Ser Phe Lys Thr Ser His Asn Ala Ile Asp Ser 435 440 445 Gln Ile Ala Gly Lys Gly Ser Ile Leu Arg Ala Leu Pro Val Asp Val 450 455 460 Leu Ala Lys Ala Tyr Met Leu Ser Arg Glu Glu Ser Arg Thr Leu Lys 465 470 475 480 Tyr Asn Arg Ala Asp Glu Thr Leu Val Phe Ala Pro Arg Pro Glu Ile 485 490 495 Gln Leu Tyr Ala Glu Ser Glu Lys 500 <210> SEQ ID NO 243 <211> LENGTH: 543 <212> TYPE: PRT <213> ORGANISM: Pisum fulvum <400> SEQUENCE: 243 Met Ala Thr Thr Thr Lys Ser Arg Phe Pro Leu Leu Leu Leu Leu Gly 1 5 10 15 Ile Ile Phe Leu Ala Ser Val Val Cys Val Thr Tyr Ala Asn Tyr Asp 20 25 30 Glu Gly Ser Glu Pro Arg Val Pro Gly Arg Arg Glu Arg Gly Arg Gln 35 40 45 Glu Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser Tyr 50 55 60 Glu Lys Glu Glu Asp Glu Glu Glu Gly Gln Arg Glu Arg Gly Arg Gln 65 70 75 80 Glu Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Gly Pro Ser Tyr 85 90 95 Glu Lys Gln Glu Asp Glu Glu Glu Lys Gln Lys Tyr Arg Tyr Gln Arg 100 105 110 Glu Lys Glu Asp Glu Glu Glu Lys Gln Lys Tyr Arg Tyr Gln Arg Glu 115 120 125 Lys Lys Glu Gln Lys Glu Val Gln Pro Gly Arg Glu Arg Trp Glu Arg 130 135 140 Glu Glu Asp Glu Glu His Val Asp Glu Glu Trp Arg Gly Ser Gln Arg 145 150 155 160 His Glu Asp Pro Glu Glu Arg Ala Arg Leu Arg Tyr Arg Glu Glu Arg 165 170 175 Thr Lys Arg Asp Arg Arg His Gln Arg Glu Gly Glu Glu Glu Glu Arg 180 185 190 Ser Ser Glu Ser Gln Glu Arg Arg Asn Pro Phe Leu Phe Lys Ser Asn 195 200 205 Lys Phe Gln Thr Leu Phe Glu Asn Glu Asn Gly His Ile Arg Leu Leu 210 215 220 Gln Arg Phe Asp Lys Arg Ser Asp Leu Phe Glu Asn Leu Gln Asn Tyr 225 230 235 240 Arg Leu Val Glu Tyr Arg Ala Lys Pro His Thr Ile Phe Leu Pro Gln 245 250 255 His Ile Asp Ala Asp Leu Ile Leu Val Val Leu Ser Gly Lys Ala Ile 260 265 270 Leu Thr Val Leu Ser Pro Asn Ala Arg Asn Ser Tyr Asn Leu Glu Arg 275 280 285 Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr Thr Ser Tyr Leu Val Asn 290 295 300 Gln Asp Asp Glu Glu Asp Leu Arg Leu Val Asp Leu Val Ile Pro Val 305 310 315 320 Asn Gly Pro Gly Lys Phe Glu Ala Phe Asp Leu Ser Lys Asn Lys Asn 325 330 335 Gln Tyr Leu Arg Gly Phe Ser Lys Asn Ile Leu Glu Ala Ser Tyr Asn 340 345 350 Thr Lys Tyr Glu Thr Ile Glu Lys Val Leu Leu Glu Glu Gln Glu Lys 355 360 365 Thr Asp Ala Ile Val Lys Val Ser Arg Glu Gln Ile Glu Glu Leu Arg 370 375 380 Lys His Ala Lys Ser Ser Ser Lys Lys Ile Phe Pro Ser Glu Phe Glu 385 390 395 400 Pro Ile Asn Leu Arg Asn His Lys Pro Glu Tyr Ser Asn Lys Phe Gly 405 410 415 Lys Leu Phe Glu Ile Thr Pro Glu Lys Lys Tyr Pro Gln Leu Gln Asp 420 425 430 Leu Asp Ile Phe Val Ser Cys Val Glu Ile Asn Glu Gly Ala Leu Met 435 440 445 Leu Pro His Tyr Asn Ser Arg Ala Ile Val Val Leu Leu Val Asn Glu 450 455 460 Gly Lys Gly Asn Leu Glu Leu Leu Gly Leu Glu Asn Glu Gln Gln Glu 465 470 475 480 Arg Glu Asp Arg Lys Glu Arg Asn Asn Glu Val Gln Arg Tyr Glu Ala 485 490 495 Arg Leu Ser Pro Gly Asp Val Val Ile Ile Pro Ala Gly His Pro Val 500 505 510 Ala Ile Thr Ala Ser Ser Asn Leu Asn Leu Leu Ala Phe Gly Ile Asn 515 520 525 Ala Glu Asn Asn Gln Arg Asn Phe Leu Ser Gly Ser Asp Asp Asn 530 535 540 <210> SEQ ID NO 244 <211> LENGTH: 526 <212> TYPE: PRT <213> ORGANISM: PISUM ABYSSINICUM <400> SEQUENCE: 244 Met Ala Thr Thr Val Glu Ser Arg Phe Pro Leu Leu Leu Phe Pro Gly 1 5 10 15 Ile Ile Phe Leu Ala Ser Val Cys Val Thr Tyr Ala Asn Tyr Asp Glu 20 25 30 Gly Ser Glu Thr Arg Val Pro Gly Gln Arg Glu Arg Gly Arg Gln Glu 35 40 45 Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser Tyr Glu 50 55 60 Lys Glu Glu Asp Glu Glu Glu Lys Gln Lys Tyr Arg Tyr Gln Arg Glu 65 70 75 80

Lys Glu Asp Glu Glu Glu Lys Gln Lys Tyr Arg Tyr Gln Arg Glu Lys 85 90 95 Lys Glu Glu Lys Glu Val Gln Pro Gly Arg Glu Arg Trp Glu Arg Glu 100 105 110 Glu Asp Glu Glu Gln Val Asp Glu Glu Trp Arg Gly Ser Gln Arg Arg 115 120 125 Gln Asp Pro Glu Glu Arg Ala Arg Leu Arg His Arg Glu Glu Arg Thr 130 135 140 Lys Arg Asp Arg Arg His Lys Arg Glu Gly Glu Glu Glu Glu Arg Ser 145 150 155 160 Ser Glu Ser Gln Glu Gln Arg Asn Pro Phe Leu Phe Lys Ser Asn Lys 165 170 175 Phe Leu Thr Leu Phe Glu Asn Glu Asn Gly His Ile Arg Arg Leu Gln 180 185 190 Arg Phe Asp Lys Arg Ser Asp Leu Phe Glu Asn Leu Gln Asn Tyr Arg 195 200 205 Leu Val Glu Tyr Arg Ala Lys Pro His Thr Ile Phe Leu Pro Gln His 210 215 220 Ile Asp Ala Asp Leu Ile Leu Val Val Leu Asn Gly Lys Ala Ile Leu 225 230 235 240 Thr Val Leu Ser Pro Asn Asp Arg Asn Ser Tyr Asn Leu Glu Arg Gly 245 250 255 Asp Thr Ile Lys Ile Pro Ala Gly Thr Thr Ser Tyr Leu Val Asn Gln 260 265 270 Asp Asp Glu Glu Asp Leu Arg Val Val Asp Phe Val Ile Pro Val Asn 275 280 285 Arg Pro Gly Lys Phe Glu Ala Phe Gly Leu Ser Glu Asn Lys Asn Gln 290 295 300 Tyr Leu Arg Gly Phe Ser Lys Asn Ile Leu Glu Ala Ser Leu Asn Thr 305 310 315 320 Lys Tyr Glu Thr Ile Glu Lys Val Leu Leu Glu Glu Gln Glu Lys Lys 325 330 335 Pro Gln Gln Leu Arg Asp Arg Lys Arg Arg Gln Gln Gly Gly Glu Arg 340 345 350 Asp Ala Ile Ile Lys Val Ser Arg Glu Gln Ile Glu Glu Leu Arg Lys 355 360 365 Leu Ala Lys Ser Ser Ser Lys Lys Ser Leu Pro Ser Glu Phe Glu Pro 370 375 380 Phe Asn Leu Arg Ser His Lys Pro Glu Tyr Ser Asn Lys Phe Gly Lys 385 390 395 400 Leu Phe Glu Ile Thr Pro Glu Lys Lys Tyr Pro Gln Leu Gln Asp Leu 405 410 415 Asp Ile Leu Val Ser Cys Val Glu Ile Asn Lys Gly Ala Leu Met Leu 420 425 430 Pro His Tyr Asn Ser Arg Ala Ile Val Val Leu Leu Val Asn Glu Gly 435 440 445 Lys Gly Asn Leu Glu Leu Leu Gly Leu Lys Asn Glu Gln Gln Glu Arg 450 455 460 Glu Asp Arg Lys Glu Arg Asn Asn Glu Val Gln Arg Tyr Glu Ala Arg 465 470 475 480 Leu Ser Pro Gly Asp Val Val Ile Ile Pro Ala Gly His Pro Val Ala 485 490 495 Ile Ser Ala Ser Ser Asn Leu Asn Leu Leu Gly Phe Gly Thr Asn Ala 500 505 510 Glu Asn Asn Gln Arg Asn Phe Leu Ser Gly Ser Asp Asp Asn 515 520 525 <210> SEQ ID NO 245 <211> LENGTH: 589 <212> TYPE: PRT <213> ORGANISM: Vicia villosa <400> SEQUENCE: 245 Met Ala Thr Thr Ile Lys Ser Arg Phe Pro Val Leu Leu Leu Leu Gly 1 5 10 15 Ile Ile Phe Leu Thr Ser Val Cys Val Thr Tyr Ala Asn Tyr Asp Glu 20 25 30 Gly Arg Glu Pro Ser Val Pro Gly Gln Arg Glu Arg Gly Arg Gln Glu 35 40 45 Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser Glu Glu 50 55 60 Asp Glu Glu Glu Lys Tyr Lys Tyr Glu Glu Gly Arg Val Pro Gly Gln 65 70 75 80 Arg Glu Arg Gly Arg Gln Glu Gly Glu Lys Glu Glu Lys Arg His Gly 85 90 95 Lys Trp Arg Pro Ser Glu Glu Glu Asp Glu Glu Glu Lys Tyr Arg Tyr 100 105 110 Glu Glu Gly Ser Glu Pro Arg Gly Pro Gly Gln Arg Glu Thr Gly Arg 115 120 125 Gln Glu Gly Glu Lys Glu Lys Gln Arg Pro Glu Arg Glu Pro Ser Tyr 130 135 140 Glu Lys Glu Glu Asp Glu Glu Glu Lys Gln Lys Tyr Gln Tyr His Arg 145 150 155 160 Glu Lys Lys Glu Gln Arg Glu Val Arg Pro Gly Arg Glu Arg Phe Glu 165 170 175 Arg His Glu Asp Glu Glu Gln Trp Arg Gly Ile Gln Arg His Glu Asp 180 185 190 Pro Glu Glu Arg Ala Arg Glu Arg Tyr Arg Ala Glu Ile Ala Lys Arg 195 200 205 Gln Val Glu Glu Glu Arg Glu Glu Arg Asp Ile Pro His Glu Arg Glu 210 215 220 Gln Arg Asn Pro Phe Leu Phe Lys Ser Asn Lys Phe Gln Thr Leu Phe 225 230 235 240 Gln Asn Glu Asn Gly Tyr Ile Arg Arg Leu Gln Arg Phe Asp Lys Arg 245 250 255 Ser Asp Leu Phe Glu Asn Leu Gln Asn Tyr Arg Leu Val Glu Tyr Arg 260 265 270 Ala Lys Pro His Thr Ile Phe Leu Pro Gln His Ile Asp Ala Asp Leu 275 280 285 Ile Ile Val Val Leu Ser Gly Arg Ala Ile Leu Thr Val Leu Ser Pro 290 295 300 Asp Asp Arg Asn Ser Tyr Asn Leu Glu Arg Gly Asp Thr Ile Lys Leu 305 310 315 320 Pro Ala Gly Thr Thr Ser Tyr Leu Val Asn Gln Asp Asp Glu Glu Asp 325 330 335 Leu Arg Val Val Asp Leu Ala Ile Pro Val Asn Arg Pro Gly Lys Val 340 345 350 Glu Ser Phe Leu Leu Ser Gly Asn Lys Asn Gln Tyr Leu Arg Gly Phe 355 360 365 Ser Lys Asn Ile Leu Glu Ala Ser Phe Asn Thr Asn Tyr Glu Thr Ile 370 375 380 Glu Arg Val Leu Leu Glu Glu Gln Asp Lys Glu Ser Gln Gln Ser Ile 385 390 395 400 Gly Gln Lys Arg Arg Ser Gln Arg Gln Glu Thr Asn Ala Leu Val Lys 405 410 415 Val Ser Arg Glu Gln Leu Glu Asp Leu Lys Arg Leu Ala Lys Ser Ser 420 425 430 Ser Gln Glu Gly Leu Ser Ser Gln Phe Glu Pro Ile Asn Leu Arg Ser 435 440 445 Gln Asn Pro Lys Tyr Ser Asn Lys Phe Gly Lys Val Phe Glu Ile Thr 450 455 460 Pro Glu Lys Lys Tyr Pro Gln Leu Gln Asp Leu Asp Leu Phe Val Ser 465 470 475 480 Ser Val Asp Ile Lys Glu Gly Ala Leu Met Leu Pro His Tyr Asn Ser 485 490 495 Arg Ala Ile Val Val Leu Leu Val Asn Glu Gly Arg Gly Asn Leu Glu 500 505 510 Leu Val Gly Leu Lys Asn Glu Gln Gln Glu Gln Arg Glu Lys Glu Asp 515 520 525 Glu Gln Gln Glu Arg Asn Asn Gln Val Gln Arg Tyr Glu Ala Arg Leu 530 535 540 Ser Pro Gly Asp Val Val Ile Ile Pro Ala Gly His Pro Val Ala Val 545 550 555 560 Arg Ala Ser Ser Asp Leu Asn Leu Leu Ala Phe Gly Ile Asn Ala Glu 565 570 575 Asn Asn Gln Arg Asn Phe Leu Ala Gly Ser Asp Asp Asn 580 585 <210> SEQ ID NO 246 <211> LENGTH: 576 <212> TYPE: PRT <213> ORGANISM: Lathyrus hirsutus <400> SEQUENCE: 246 Met Ala Ile Ile Ile Lys Ser Arg Phe Pro Leu Leu Leu Leu Leu Gly 1 5 10 15 Ile Ile Phe Leu Ala Ser Val Cys Ala Thr Trp Ala Asn Tyr Asp Glu 20 25 30 Gly Ser Glu Pro Arg Val Pro Gly Gln Arg Glu Arg Gly Arg Gln Glu 35 40 45 Gly Glu Lys Ala Glu Lys Ser His Glu Lys Trp Arg Pro Ser Tyr Glu 50 55 60 Glu Glu Tyr Asp Glu Gly Ser Glu Pro Arg Val Pro Gly Lys Arg Glu 65 70 75 80 Arg Gly Arg Gln Glu Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp 85 90 95 Arg Pro Ser His Glu Glu Glu Tyr Asp Glu Gly Ser Glu Pro Arg Val 100 105 110 Pro Thr His Gly Glu Arg Gly Arg Gln Glu Gly Glu Lys Glu Glu Lys 115 120 125 Arg His Glu Glu Trp Arg Pro Ser Tyr Glu Lys Glu Glu Asp Glu Glu 130 135 140 Glu Lys Glu Lys Tyr Lys Tyr Gln Arg Glu Lys Lys Glu Gln Lys Glu 145 150 155 160 Val Gln Pro Gly Arg Glu Lys Trp Glu Arg Lys Gln Asp Glu Lys His 165 170 175 Val Glu Glu Asp Glu Asp Gln Glu Glu Glu Gln Trp Arg Gly Ser Lys 180 185 190 Arg Arg Glu Asp Pro Glu Glu Arg Ala Arg Leu Arg Tyr Arg Glu Glu 195 200 205 Arg Thr Lys Ser Asn Val Glu Glu Glu Thr Glu Glu Arg Arg Asn Pro

210 215 220 Phe Leu Phe Lys Ser Asn Lys Phe Leu Thr Leu Phe Glu Asn Glu Asn 225 230 235 240 Gly His Ile Arg Arg Leu Gln Arg Phe Asp Glu Arg Ser Asp Ile Phe 245 250 255 Glu Asn Leu Gln Asn Tyr Arg Leu Val Glu Tyr Lys Ala Lys Pro His 260 265 270 Thr Met Phe Leu Pro Gln His Ile Asp Ala Asp Leu Ile Ile Val Val 275 280 285 Leu Asn Gly Lys Ala Ile Leu Thr Val Leu Ser Pro Asn Asp Arg Asn 290 295 300 Ser Tyr Asn Leu Glu Arg Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr 305 310 315 320 Thr Ser Tyr Leu Val Asn Gln Asp Asp Glu Glu Asp Leu Arg Val Val 325 330 335 Asp Leu Ala Ile Pro Val Asn Arg Pro Gly Lys Phe Glu Ala Phe Gly 340 345 350 Leu Ser Ala Asn Lys Asn Gln Tyr Leu Arg Gly Phe Ser Lys Asn Ile 355 360 365 Leu Glu Ala Phe Leu Asn Thr Lys Tyr Glu Thr Ile Glu Lys Val Leu 370 375 380 Leu Glu Glu Gln Glu Arg Arg Asp Arg Lys Gly Arg Gln Gln Gly Gln 385 390 395 400 Glu Thr Asn Ala Ile Val Lys Val Ser Arg Glu Gln Ile Glu Glu Leu 405 410 415 Arg Lys Leu Ala Lys Ser Ser Ser Lys Lys Ser Leu Leu Ser Glu Ser 420 425 430 Glu Pro Ile Asn Leu Arg Ser Gln Asn Pro Lys Tyr Ser Asn Lys Phe 435 440 445 Gly Lys Leu Phe Glu Ile Thr Pro Glu Lys Lys Tyr Pro Gln Leu Gln 450 455 460 Asp Leu Asp Val Ser Ile Ser Cys Val Glu Ile Asn Glu Gly Ala Pro 465 470 475 480 Leu Leu Pro His Tyr Asn Ser Arg Ala Ile Val Leu Leu Leu Val Asn 485 490 495 Glu Gly Lys Gly Asn Leu Glu Leu Val Gly Phe Lys Asn Glu Gln Gln 500 505 510 Arg Gln Arg Glu Asn Glu Glu Arg Asn Lys Lys Val Gln Arg Tyr Glu 515 520 525 Ala Arg Leu Ser Pro Gly Asp Val Val Val Ile Pro Ala Gly His Pro 530 535 540 Val Ala Ile Ser Ala Ser Leu Asn Leu Asn Leu Val Gly Phe Gly Val 545 550 555 560 Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Thr Gly Ser Asp Asp Asn 565 570 575 <210> SEQ ID NO 247 <211> LENGTH: 564 <212> TYPE: PRT <213> ORGANISM: Lathyrus cicera <400> SEQUENCE: 247 Met Ala Thr Ile Ile Lys Ser Arg Phe Pro Leu Leu Leu Leu Leu Gly 1 5 10 15 Ile Ile Phe Leu Ala Ser Val Cys Val Thr Leu Ala Asn Tyr Asp Glu 20 25 30 Gly Ser Glu Pro Arg Val Pro Ala Gln Arg Glu Arg Gly Arg Gln Glu 35 40 45 Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser His Glu 50 55 60 Lys Glu Tyr Asp Glu Gly Ser Glu Pro Arg Val Pro Gly Arg Arg Glu 65 70 75 80 Arg Gly Arg Gln Glu Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp 85 90 95 Arg Pro Ser Tyr Glu Lys Glu Tyr Asp Glu Gly Ser Glu Pro Arg Val 100 105 110 Pro Gly Arg Arg Glu Arg Gly Arg Gln Glu Gly Glu Lys Glu Glu Lys 115 120 125 Arg His Gly Glu Trp Arg Pro Ser Tyr Glu Lys Glu Tyr Asp Glu Glu 130 135 140 Glu Lys Gln Lys Tyr Gln Tyr Glu Arg Glu Lys Glu Glu Gln Lys Glu 145 150 155 160 Val Gln Pro Gly Arg Glu Arg Trp Glu Arg Lys Glu Asp Glu Glu Lys 165 170 175 Glu Glu Asp Gln Trp Arg Gly Ser Gln Arg His Glu Asp Pro Glu Glu 180 185 190 Arg Ala Arg Leu Arg Tyr Arg Lys Glu Arg Thr Lys Lys Tyr Val Glu 195 200 205 Glu Asp Thr Glu Glu Thr Ser Ser Glu Ser Gln Gly Arg Arg Asn Pro 210 215 220 Phe Leu Phe Lys Ser Asn Lys Phe Leu Thr Leu Phe Glu Asn Glu Asn 225 230 235 240 Gly Tyr Ile Arg Arg Leu Gln Arg Phe Asp Glu Arg Ser Asp Ile Phe 245 250 255 Glu Asn Leu Gln Asn Tyr Arg Leu Val Glu Tyr Arg Ala Lys Pro His 260 265 270 Thr Ile Phe Leu Pro Gln His Ile Asp Ala Asp Leu Ile Leu Val Ile 275 280 285 Leu Asn Gly Lys Ala Ile Leu Thr Val Leu Ser Pro Asn Asp Arg Asn 290 295 300 Ser Tyr Asn Leu Glu Arg Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr 305 310 315 320 Thr Ser Tyr Leu Val Asn Glu Asp Asp Glu Glu Asp Leu Arg Val Val 325 330 335 Asp Leu Val Ile Pro Val Asn Arg Pro Gly Lys Phe Glu Ala Phe Asp 340 345 350 Leu Asn Gln Tyr Leu Gly Gly Phe Ser Lys Ser Val Leu Glu Ala Ser 355 360 365 Leu Asn Thr Lys Tyr Glu Thr Ile Glu Lys Val Leu Leu Glu Glu Gln 370 375 380 Gln Lys Gln Gly Gln Glu Thr Asn Ala Ile Val Lys Val Ser Arg Glu 385 390 395 400 Gln Ile Glu Glu Leu Arg Lys Leu Ala Lys Ser Ser Ser Lys Lys Ser 405 410 415 Leu Leu Ser Glu Leu Glu Pro Val Asn Leu Arg Ser His Ser Pro Lys 420 425 430 Tyr Ser Asn Lys Phe Gly Lys Phe Phe Glu Ile Thr Pro Glu Lys Lys 435 440 445 Tyr Pro Gln Leu Gln Asp Leu Asp Val Ser Ile Ser Cys Val Glu Ile 450 455 460 Asn Glu Gly Ala Leu Leu Leu Pro His Tyr Asn Ser Arg Ala Ile Val 465 470 475 480 Val Val Leu Val Asn Glu Gly Lys Gly Asn Leu Glu Leu Leu Gly Val 485 490 495 Gln Asn Glu Asp Glu Gln Gln Glu Arg Lys Glu Arg Asn Lys Glu Val 500 505 510 Gln Arg Tyr Glu Ala Arg Leu Ser Pro Gly Asp Val Val Ile Ile Pro 515 520 525 Ser Gly His Pro Val Ala Val Ser Ala Ser Ser Asn Leu Asn Leu Leu 530 535 540 Gly Phe Gly Ile Asn Ala Glu Asn Asn Gln Arg Asn Phe Leu Ser Gly 545 550 555 560 Ser Asp Asp Asn <210> SEQ ID NO 248 <211> LENGTH: 527 <212> TYPE: PRT <213> ORGANISM: Lathyrus sativus <400> SEQUENCE: 248 Met Ala Thr Ile Ile Lys Ser Arg Phe Pro Leu Leu Leu Leu Leu Gly 1 5 10 15 Ile Ile Phe Leu Ala Ser Val Cys Val Thr Tyr Ala Asn Tyr Asp Glu 20 25 30 Gly Ser Glu Pro Arg Val Pro Ala Gln Arg Glu Arg Gly Arg Gln Glu 35 40 45 Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp Arg Pro Ser Ser Glu 50 55 60 Lys Glu Tyr Asp Glu Gly Ser Glu Pro Arg Val Pro Gly Arg Arg Glu 65 70 75 80 Arg Gly Arg Gln Glu Gly Glu Lys Glu Glu Lys Arg His Gly Glu Trp 85 90 95 Arg Pro Ser Tyr Glu Lys Glu Tyr Asp Glu Glu Glu Lys Gln Lys Tyr 100 105 110 Gln Tyr Glu Arg Glu Lys Lys Glu Gln Lys Glu Val Glu Pro Gly Arg 115 120 125 Glu Arg Trp Glu Arg Lys Glu Asp Glu Glu Lys Glu Glu Asp Gln Trp 130 135 140 Arg Gly Ser Gln Arg His Glu Asp Pro Glu Glu Arg Ala Arg Leu Arg 145 150 155 160 Tyr Arg Lys Glu Arg Thr Lys Lys Tyr Val Glu Glu Asp Thr Glu Glu 165 170 175 Thr Ser Ser Glu Ser Gln Gly Arg Arg Asn Pro Phe Leu Phe Lys Ser 180 185 190 Asn Lys Phe Leu Thr Leu Phe Glu Asn Glu Asn Gly Tyr Ile Arg Arg 195 200 205 Leu Gln Arg Phe Asp Glu Arg Ser Asp Leu Phe Glu Asn Leu Gln Asn 210 215 220 Tyr Arg Leu Val Glu Tyr Arg Ala Lys Pro His Thr Ile Phe Leu Pro 225 230 235 240 Gln His Ile Asp Ala Asp Leu Ile Leu Val Ile Leu Asn Gly Lys Ala 245 250 255 Ile Leu Thr Val Leu Ser Pro Asn Asp Arg Asn Ser Tyr Asn Leu Glu 260 265 270 Arg Gly Asp Thr Ile Lys Leu Pro Ala Gly Thr Thr Ser Tyr Leu Val 275 280 285 Asn Glu Asp Asp Glu Glu Asp Leu Arg Val Val Asp Leu Val Ile Pro 290 295 300 Val Asn Arg Pro Gly Lys Phe Glu Ala Phe Asp Leu Asn Gln Tyr Leu 305 310 315 320

Gly Gly Phe Ser Lys Ser Val Leu Lys Ala Ser Leu Asn Thr Lys Tyr 325 330 335 Glu Thr Ile Glu Lys Val Leu Leu Glu Glu Gln Gln Lys Gln Gly Gln 340 345 350 Glu Thr Asn Ala Ile Val Lys Val Ser Arg Glu Gln Ile Glu Glu Leu 355 360 365 Arg Lys Leu Ala Lys Ser Ser Ser Lys Lys Ser Leu Leu Ser Glu Leu 370 375 380 Glu Pro Val Asn Leu Arg Ser His Ser Pro Lys Tyr Ser Asn Lys Phe 385 390 395 400 Gly Lys Phe Phe Glu Ile Thr Pro Glu Lys Lys Tyr Pro Gln Leu Gln 405 410 415 Asp Leu Asp Val Ser Ile Ser Cys Val Glu Ile Asn Glu Gly Ala Leu 420 425 430 Leu Leu Pro His Tyr Asn Ser Arg Ala Ile Val Val Leu Leu Val Asn 435 440 445 Glu Gly Lys Gly Asn Leu Glu Leu Leu Gly Val Gln Asp Glu Asp Glu 450 455 460 Gln Gln Glu Arg Lys Lys Arg Asn Lys Glu Val Gln Arg Tyr Glu Ala 465 470 475 480 Arg Leu Ser Pro Ser Asp Val Val Ile Ile Pro Ala Gly His Pro Val 485 490 495 Ala Val Ser Ala Ser Ser Asn Leu Asn Leu Leu Gly Phe Gly Ile Asn 500 505 510 Ala Glu Asn Asn Glu Arg Asn Phe Leu Ser Gly Ser Asp Asp Asn 515 520 525 <210> SEQ ID NO 249 <211> LENGTH: 495 <212> TYPE: PRT <213> ORGANISM: Oryza brachyantha <400> SEQUENCE: 249 Met Ala Thr Thr Val Phe Ser Arg Phe Ser Thr Tyr Phe Cys Val Leu 1 5 10 15 Leu Leu Cys His Gly Ser Met Ala Gln Leu Phe Asn Pro Ser Thr Asn 20 25 30 Pro Trp His Asn Pro Arg Gln Gly Ser Ser Arg Glu Cys Arg Phe Asp 35 40 45 Arg Leu Gln Pro Phe Glu Pro Leu Arg Lys Val Arg Ser Glu Ala Gly 50 55 60 Val Thr Glu Tyr Phe Asp Glu Lys Asn Glu Leu Phe Gln Cys Thr Gly 65 70 75 80 Thr Phe Val Ile Arg Arg Val Ile Gln Pro Gln Gly Leu Leu Val Pro 85 90 95 Arg Tyr Thr Asn Ala Pro Gly Leu Val Tyr Ile Ile Gln Gly Arg Gly 100 105 110 Ser Ile Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Tyr Gln Gln Gln 115 120 125 Phe Gln Gln Phe Leu Pro Gln Glu Gln Ser Gln Ser Gln Lys Phe Arg 130 135 140 Asp Glu His Gln Lys Ile His Gln Phe Arg Gln Gly Asp Ile Val Ala 145 150 155 160 Leu Pro Ala Gly Val Ala His Trp Phe Tyr Asn Asp Gly Asp Ala Pro 165 170 175 Val Val Ala Val Tyr Val Tyr Asp Val Lys Asn Ser Ala Asn Gln Leu 180 185 190 Glu Pro Arg Gln Arg Glu Phe Leu Leu Gly Gly Asn Asn Met Arg Ala 195 200 205 Gln Gln Val Tyr Gly Ser Ser Ala Glu Gln His Ser Arg Gln Asn Ile 210 215 220 Phe Ser Gly Phe Gly Val Glu Ile Leu Ser Glu Ala Leu Gly Ile Ser 225 230 235 240 Thr Val Thr Thr Lys Arg Leu Gln Ser Gln Asn Asp Gln Arg Gly Glu 245 250 255 Ile Ile His Val Lys Asn Gly Leu Gln Phe Leu Lys Pro Thr Leu Thr 260 265 270 Gln Gln Gln Glu Gln Ala Gln Ala Gln Tyr Gln Glu Val Gln Tyr Ser 275 280 285 Glu Gln Gln Gln Thr Ser Ser Arg Trp Asn Gly Leu Asp Glu Asn Phe 290 295 300 Cys Thr Ile Lys Ala Arg Met Asn Ile Glu Asn Thr Ser Arg Ala Asp 305 310 315 320 Thr Tyr Asn Pro Arg Ala Gly Arg Thr Thr Ser Leu Asn Ser Gln Lys 325 330 335 Phe Pro Ile Leu Asn Leu Val Gln Met Ser Ala Thr Arg Val Asn Leu 340 345 350 Tyr Gln Asn Ala Ile Leu Ser Thr Phe Trp Asn Val Asn Ala His Ser 355 360 365 Leu Val Tyr Thr Ile Gln Gly Arg Ala Arg Val Gln Val Val Ser Asn 370 375 380 Phe Gly Lys Thr Val Phe Asp Gly Glu Leu Arg Pro Gly Gln Leu Leu 385 390 395 400 Ile Ile Pro Gln His Tyr Val Val Leu Lys Lys Ala Gln Arg Glu Gly 405 410 415 Phe Arg Tyr Ile Ala Ile Lys Thr Asn Ala Asn Ala Phe Val Ser Gln 420 425 430 Leu Val Gly Lys Asn Ser Val Phe Arg Ser Leu Pro Val Asp Val Ile 435 440 445 Ala Asn Val Tyr Arg Ile Ser Arg Glu Gln Ala Arg Ser Leu Lys Asn 450 455 460 Asn Arg Gly Glu Glu His Gly Ala Phe Ala Pro Arg Ser Gln Gln Gln 465 470 475 480 Ser Tyr Pro Gly Phe Ser Asn Gln Ser Glu Ser Glu Thr Ser Glu 485 490 495 <210> SEQ ID NO 250 <211> LENGTH: 494 <212> TYPE: PRT <213> ORGANISM: Oryza brachyantha <400> SEQUENCE: 250 Met Ala Thr Thr Thr Phe Ser Arg Phe Ser Ile Tyr Phe Cys Val Leu 1 5 10 15 Leu Leu Cys His Gly Ser Met Ala Gln Leu Phe Ser Pro Thr Leu Asn 20 25 30 Pro Trp His Ser Ser Arg Arg Gly Gly Ser Arg Asp Cys Arg Phe Asp 35 40 45 Arg Leu Gln Ala Phe Glu Pro Leu Arg Arg Val Arg Ser Glu Ala Gly 50 55 60 Val Thr Glu Tyr Phe Asp Glu Arg Asn Glu Gln Phe Gln Cys Thr Gly 65 70 75 80 Thr Phe Val Ile Arg Arg Val Ile Glu Pro Gln Gly Leu Leu Val Pro 85 90 95 Arg Tyr Thr Asn Thr Pro Gly Val Val Tyr Ile Met Gln Gly Arg Gly 100 105 110 Ser Met Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Tyr Gln Gln Gln 115 120 125 Phe Gln Gln Phe Leu Pro Glu Gly Gln Ser Gln Ser Gln Lys Phe Arg 130 135 140 Asp Glu His Gln Lys Ile His Gln Phe Arg Gln Gly Asp Ile Val Ala 145 150 155 160 Leu Pro Ala Gly Val Ala His Trp Phe Tyr Asn Glu Gly Asp Thr Pro 165 170 175 Val Val Ala Leu Tyr Val Phe Asp Ile Asn Asn Ser Ala Asn Gln Leu 180 185 190 Glu Pro Arg Gln Lys Asp Phe Leu Leu Ala Gly Asn Asn Asn Arg Glu 195 200 205 Gln Gln Val Tyr Gly Arg Ser Ile Glu Lys His Ser Gly Gln Asn Ile 210 215 220 Phe Ser Gly Phe Asn His Glu Leu Leu Ser Glu Ala Leu Gly Ile Ser 225 230 235 240 Thr Leu Ala Ala Lys Arg Leu Gln Gly Gln Asn Asp His Arg Gly Glu 245 250 255 Ile Ile Arg Val Arg Asn Gly Leu Gln Leu Leu Lys Pro Thr Phe Thr 260 265 270 Gln Gln Gln Glu Gln Ala Gln Ser Gln Tyr Gln Val Gln Tyr Ser Glu 275 280 285 Lys Gln Gln Glu Ser Thr Arg Cys Asn Gly Leu Asp Glu Asn Phe Cys 290 295 300 Thr Ile Asn Ala Arg Leu Asn Ile Glu Asn Pro Ser Arg Ala Asp Thr 305 310 315 320 Tyr Asn Pro Arg Ala Gly Arg Ile Thr His Leu Asn Asn Gln Lys Phe 325 330 335 Pro Ile Leu Asn Leu Val Gln Met Ser Ala Thr Arg Val Asn Leu Tyr 340 345 350 Gln Asn Ala Ile Leu Ser Pro Tyr Trp Asn Val Asn Ala His Ser Leu 355 360 365 Val Tyr Met Val Gln Gly His Ala Arg Val Gln Val Val Ser Asn Leu 370 375 380 Gly Lys Thr Val Phe Asn Ser Val Leu Arg Pro Gly Gln Leu Leu Ile 385 390 395 400 Ile Pro Gln His Tyr Val Val Leu Lys Lys Ala Glu Arg Glu Gly Cys 405 410 415 Gln Tyr Ile Ala Phe Lys Thr Asn Ala Asn Ser Ile Val Ser Gln Leu 420 425 430 Ala Gly Lys Asn Ser Ile Leu Arg Ala Met Pro Val Asp Val Val Ala 435 440 445 Asn Ala Tyr Arg Ile Ser Arg Glu Gln Ala Arg Asp Leu Lys Asn Asn 450 455 460 Arg Gly Glu Glu Leu Gly Ala Phe Thr Pro Lys Phe Glu Gln Gln Ser 465 470 475 480 Tyr Pro Gly Leu Ser Asn Glu Ser Glu Ser Glu Ala Ser Glu 485 490 <210> SEQ ID NO 251 <211> LENGTH: 500 <212> TYPE: PRT <213> ORGANISM: Zizania latifolia <400> SEQUENCE: 251 Met Asn Met Ala Thr Ile Asn Gly Pro Thr Ile Phe Phe Thr Val Cys 1 5 10 15

Leu Phe Leu Leu Cys His Gly Ser Leu Ala Gln Leu Leu Gly Gln Ser 20 25 30 Thr Ser Gln Trp Gln Ser Ser His Arg Gly Ser Ser Arg Gln Cys Arg 35 40 45 Phe Asp Arg Leu Gln Ala Phe Glu Pro Val Arg Ser Val Arg Ser Gln 50 55 60 Ala Gly Thr Thr Glu Phe Phe Asp Ala Ser Asn Glu Leu Phe Gln Cys 65 70 75 80 Ala Gly Val Ser Ile Val Arg Arg Ile Ile Glu Pro Arg Gly Leu Leu 85 90 95 Leu Pro Gln Tyr Thr Asn Gly Ala Thr Ile Met Tyr Ile Ile Gln Gly 100 105 110 Arg Gly Ile Thr Gly Gln Thr Phe Pro Gly Cys Pro Glu Ser Tyr Gln 115 120 125 Gln Gln Phe Gln Gln Ser Met Gln Ala Gln Leu Thr Gly Ser Gln Ser 130 135 140 Gln Ser Gln Lys Phe Lys Asp Glu His Gln Lys Ile Asn Arg Phe Arg 145 150 155 160 Gln Gly Asp Val Ile Ala Leu Pro Ala Gly Val Ala His Trp Cys Tyr 165 170 175 Asn Asp Gly Glu Val Pro Val Val Ala Ile Tyr Val Ile Asp Ile Asn 180 185 190 Asn Ala Ala Asn Gln Leu Asp Pro Arg Gln Arg Asp Phe Leu Leu Ala 195 200 205 Gly Asn Met Arg Ser Pro Gln Ala Tyr Arg Arg Glu Val Glu Asn Gln 210 215 220 Ser Gln Asn Ile Phe Ser Gly Phe Ser Ala Glu Leu Leu Ser Glu Ala 225 230 235 240 Leu Gly Ile Ser Thr Gly Val Ala Arg Gln Leu Gln Cys Gln Asn Asp 245 250 255 Gln Arg Gly Glu Ile Val Arg Val Glu His Gly Leu Ser Leu Leu Gln 260 265 270 Pro Tyr Ala Ser Leu Gln Glu Gln Glu Gln Lys Gln Glu Gln Pro Arg 275 280 285 Glu Arg Tyr Gln Val Thr Gln His Gln Gln Ser Gln Tyr Gly Gly Gly 290 295 300 Cys Ser Asn Gly Leu Asp Glu Thr Phe Cys Ala Met Arg Ile Trp Gln 305 310 315 320 Asn Ile Asp Asn Pro Asn Leu Ala Asp Thr Tyr Asn Pro Arg Ala Gly 325 330 335 Arg Val Thr Asn Leu Asn Ser Gln Lys Phe Pro Ile Leu Asn Leu Ile 340 345 350 Gln Met Ser Ala Val Lys Val Asn Leu Tyr Gln Asn Ala Leu Leu Ser 355 360 365 Pro Phe Trp Asn Ile Asn Ser His Ser Val Val Tyr Val Thr Gln Gly 370 375 380 Cys Ala Arg Val Gln Val Val Asn Asn Asn Gly Lys Thr Val Phe Asn 385 390 395 400 Gly Glu Leu Arg Arg Gly Gln Leu Leu Ile Ile Pro Gln His Tyr Val 405 410 415 Val Val Lys Lys Ala Gln Arg Glu Gly Cys Ala Tyr Ile Ala Phe Lys 420 425 430 Thr Asn Pro Asn Ser Met Val Ser His Ile Val Gly Lys Ser Ser Ile 435 440 445 Phe Arg Ala Leu Pro Thr Asp Val Leu Ala Asn Ala Tyr Arg Ile Ser 450 455 460 Arg Glu Asp Ala Gln Arg Leu Lys His Asn Arg Gly Asp Glu Leu Gly 465 470 475 480 Ala Phe Thr Pro Leu Gln Tyr Lys Ser Tyr Gln Asp Val Ser Ser Val 485 490 495 Ala Ala Ser Ser 500 <210> SEQ ID NO 252 <211> LENGTH: 454 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 252 Cys Arg Phe Asp Arg Leu Gln Ala Phe Glu Pro Ile Arg Ser Val Arg 1 5 10 15 Ser Gln Ala Gly Thr Thr Glu Phe Phe Asp Val Ser Asn Glu Gln Phe 20 25 30 Gln Cys Thr Gly Val Ser Ala Val Arg Arg Val Ile Glu Pro Arg Gly 35 40 45 Leu Leu Leu Pro His Tyr Thr Asn Gly Ala Ser Leu Val Tyr Ile Ile 50 55 60 Gln Gly Arg Gly Ile Thr Gly Pro Thr Phe Pro Gly Cys Pro Glu Ser 65 70 75 80 Tyr Gln Gln Gln Phe Gln Gln Ser Gly Gln Ala Gln Leu Thr Glu Ser 85 90 95 Gln Ser Gln Ser His Lys Phe Lys Asp Glu His Gln Lys Ile His Arg 100 105 110 Phe Arg Gln Gly Asp Val Ile Ala Leu Pro Ala Gly Val Ala His Trp 115 120 125 Cys Tyr Asn Asp Gly Glu Val Pro Val Val Ala Ile Tyr Val Thr Asp 130 135 140 Leu Asn Asn Gly Ala Asn Gln Leu Asp Pro Arg Gln Arg Asp Phe Leu 145 150 155 160 Leu Ala Gly Asn Lys Arg Asn Pro Gln Ala Tyr Arg Arg Glu Val Glu 165 170 175 Glu Arg Ser Gln Asn Ile Phe Ser Gly Phe Ser Thr Glu Leu Leu Ser 180 185 190 Glu Ala Leu Gly Val Ser Ser Gln Val Ala Arg Gln Leu Gln Cys Gln 195 200 205 Asn Asp Gln Arg Gly Glu Ile Val Arg Val Glu His Gly Leu Ser Leu 210 215 220 Leu Gln Pro Tyr Ala Ser Leu Gln Glu Gln Glu Gln Gly Gln Val Gln 225 230 235 240 Ser Arg Glu Arg Tyr Gln Glu Gly Gln Tyr Gln Gln Ser Gln Tyr Gly 245 250 255 Ser Gly Cys Ser Asn Gly Leu Asp Glu Thr Phe Cys Thr Met Lys Val 260 265 270 Arg Gln Asn Ile Asp Asn Pro Asn Arg Ala Asp Thr Tyr Asn Pro Arg 275 280 285 Ala Gly Arg Val Thr Asn Leu Asn Thr Gln Asn Phe Pro Ile Leu Asn 290 295 300 Leu Val Gln Met Ser Ala Val Lys Val Asn Leu Tyr Gln Asn Ala Leu 305 310 315 320 Leu Ser Pro Phe Trp Asn Ile Asn Ala His Ser Val Val Tyr Ile Thr 325 330 335 Gln Gly Arg Ala Arg Val Gln Val Val Asn Asn Asn Gly Lys Thr Val 340 345 350 Phe Asn Gly Glu Leu Arg Arg Gly Gln Leu Leu Ile Ile Pro Gln His 355 360 365 Tyr Ala Val Val Lys Lys Ala Gln Arg Glu Gly Cys Ala Tyr Ile Ala 370 375 380 Phe Lys Thr Asn Pro Asn Ser Met Val Ser His Ile Ala Gly Lys Ser 385 390 395 400 Ser Ile Phe Arg Ala Leu Pro Asn Asp Val Leu Ala Asn Ala Tyr Arg 405 410 415 Ile Ser Arg Glu Glu Ala Gln Arg Leu Lys His Asn Arg Gly Asp Glu 420 425 430 Phe Gly Ala Phe Thr Pro Ile Gln Tyr Lys Ser Tyr Gln Asp Val Tyr 435 440 445 Asn Ala Ala Glu Ser Ser 450 <210> SEQ ID NO 253 <211> LENGTH: 500 <212> TYPE: PRT <213> ORGANISM: Zizania latifolia <400> SEQUENCE: 253 Met Asn Met Ala Thr Ile Asn Gly Pro Thr Ile Phe Phe Thr Val Cys 1 5 10 15 Leu Phe Leu Leu Cys His Gly Ser Leu Ala Gln Leu Leu Gly Gln Ser 20 25 30 Thr Ser Gln Trp Gln Ser Ser His Arg Gly Ser Ser Arg Gln Cys Arg 35 40 45 Phe Asp Arg Leu Gln Ala Phe Glu Pro Val Arg Ser Val Arg Ser Gln 50 55 60 Ala Gly Thr Thr Glu Phe Phe Asp Ala Ser Asn Glu Leu Phe Gln Cys 65 70 75 80 Ala Gly Val Ser Ile Val Arg Arg Ile Ile Glu Pro Arg Gly Leu Leu 85 90 95 Leu Pro Gln Tyr Thr Asn Gly Ala Thr Ile Met Tyr Ile Ile Gln Gly 100 105 110 Arg Gly Ile Thr Gly Gln Thr Phe Pro Gly Cys Pro Glu Ser Tyr Gln 115 120 125 Gln Gln Phe Gln Gln Ser Met Gln Ala Gln Leu Thr Gly Ser Gln Ser 130 135 140 Gln Ser Gln Lys Phe Lys Asp Glu His Gln Lys Ile Asn Arg Phe Arg 145 150 155 160 Gln Gly Asp Val Ile Ala Leu Pro Ala Gly Val Ala His Trp Cys Tyr 165 170 175 Asn Asp Gly Glu Val Pro Val Val Ala Ile Tyr Val Ile Asp Ile Asn 180 185 190 Asn Ala Ala Asn Gln Leu Asp Pro Arg Gln Arg Asp Phe Leu Leu Ala 195 200 205 Gly Asn Met Arg Ser Pro Gln Ala Tyr Arg Arg Glu Val Glu Asn Gln 210 215 220 Ser Gln Asn Ile Phe Ser Gly Phe Ser Ala Glu Leu Leu Ser Glu Ala 225 230 235 240 Leu Gly Ile Ser Thr Gly Val Ala Arg Gln Leu Gln Cys Gln Asn Asp 245 250 255 Gln Arg Gly Glu Ile Val Arg Val Glu His Gly Leu Ser Leu Leu Gln 260 265 270 Pro Tyr Ala Ser Leu Gln Glu Gln Glu Gln Lys Gln Glu Gln Pro Arg 275 280 285

Glu Arg Tyr Gln Val Thr Gln His Gln Gln Ser Gln Tyr Gly Gly Gly 290 295 300 Cys Ser Asn Gly Leu Asp Glu Thr Phe Cys Ala Met Arg Ile Trp Gln 305 310 315 320 Asn Ile Asp Asn Pro Asn Leu Ala Asp Thr Tyr Asn Pro Arg Ala Gly 325 330 335 Arg Val Thr Asn Leu Asn Ser Gln Lys Phe Pro Ile Leu Asn Leu Ile 340 345 350 Gln Met Ser Ala Val Lys Val Asn Leu Tyr Gln Asn Ala Leu Leu Ser 355 360 365 Pro Phe Trp Asn Ile Asn Ser His Ser Val Val Tyr Val Thr Gln Gly 370 375 380 Cys Ala Arg Val Gln Val Val Asn Asn Asn Gly Lys Thr Val Phe Asn 385 390 395 400 Gly Glu Leu Arg Arg Gly Gln Leu Leu Ile Ile Pro Gln His Tyr Val 405 410 415 Val Val Lys Lys Ala Gln Arg Glu Gly Cys Ala Tyr Ile Ala Phe Lys 420 425 430 Thr Asn Pro Asn Ser Met Val Ser His Ile Val Gly Lys Ser Ser Ile 435 440 445 Phe Arg Ala Leu Pro Thr Asp Val Leu Ala Asn Ala Tyr Arg Ile Ser 450 455 460 Arg Glu Asp Ala Gln Arg Leu Lys His Asn Arg Gly Asp Glu Leu Gly 465 470 475 480 Ala Phe Thr Pro Leu Gln Tyr Lys Ser Tyr Gln Asp Val Ser Ser Val 485 490 495 Ala Ala Ser Ser 500 <210> SEQ ID NO 254 <211> LENGTH: 527 <212> TYPE: PRT <213> ORGANISM: Avena sativa <400> SEQUENCE: 254 Met Ala Thr Thr Ser Phe Pro Ser Met Leu Phe Tyr Phe Cys Ile Phe 1 5 10 15 Leu Leu Phe His Gly Ser Met Ala Gln Leu Phe Gly Gln Ser Ser Thr 20 25 30 Pro Trp Gln Ser Ser Arg Gln Gly Gly Leu Arg Gly Cys Arg Phe Asp 35 40 45 Arg Leu Gln Ala Phe Glu Pro Leu Arg Gln Val Arg Ser Gln Ala Gly 50 55 60 Ile Thr Glu Tyr Phe Asp Glu Gln Asn Glu Gln Phe Arg Cys Thr Gly 65 70 75 80 Val Ser Val Ile Arg Arg Val Ile Glu Pro Gln Gly Leu Val Leu Pro 85 90 95 Gln Tyr His Asn Ala Pro Ala Leu Val Tyr Ile Leu Gln Gly Arg Gly 100 105 110 Phe Thr Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Phe Gln Gln Gln 115 120 125 Phe Gln Pro Phe Asp Gln Ser Gln Phe Ala Gln Gly Gln Arg Gln Ser 130 135 140 Gln Thr Ile Lys Asp Glu His Gln Arg Val Gln Arg Phe Lys Gln Gly 145 150 155 160 Asp Val Val Ala Leu Pro Ala Gly Ile Val His Trp Cys Tyr Asn Asp 165 170 175 Gly Asp Ala Pro Ile Val Ala Ile Tyr Val Phe Asp Val Asn Asn Asn 180 185 190 Ala Asn Gln Leu Glu Pro Arg Gln Lys Glu Phe Leu Leu Ala Gly Asn 195 200 205 Asn Lys Arg Glu Gln Gln Ser Gly Asn Asn Ile Phe Ser Gly Leu Ser 210 215 220 Val Gln Leu Leu Ser Glu Ala Leu Gly Ile Ser Gln Gln Ala Ala Gln 225 230 235 240 Arg Ile Gln Ser Gln Asn Asp Gln Arg Gly Glu Ile Ile Arg Val Ser 245 250 255 Gln Gly Leu Gln Phe Leu Lys Pro Ile Val Ser Gln Gln Val Pro Gly 260 265 270 Glu Gln Gln Val Tyr Gln Pro Ile Gln Thr Gln Glu Gly Gln Ala Thr 275 280 285 Gln Tyr Gln Val Gly Gln Ser Thr Gln Tyr Gln Val Gly Lys Ser Thr 290 295 300 Pro Tyr Gln Gly Gly Gln Ser Ser Gln Tyr Gln Ala Gly Gln Ser Trp 305 310 315 320 Asp Gln Ser Phe Asn Gly Leu Glu Glu Asn Phe Cys Ser Leu Glu Ala 325 330 335 Arg Lys Asn Ile Glu Asn Pro Gln His Ala Asp Thr Tyr Asn Pro Arg 340 345 350 Ala Gly Arg Ile Thr Arg Leu Asn Ser Lys Asn Phe Pro Ile Leu Asn 355 360 365 Ile Val Gln Met Ser Ala Thr Arg Val Asn Leu Tyr Gln Asn Ala Ile 370 375 380 Leu Ser Pro Phe Trp Asn Ile Asn Ala His Ser Val Ile Tyr Met Ile 385 390 395 400 Gln Gly His Ala Arg Val Gln Val Val Asn Asn Asn Gly Gln Thr Val 405 410 415 Phe Asn Asp Ile Leu Arg Arg Gly Gln Leu Leu Ile Val Pro Gln His 420 425 430 Phe Val Val Leu Lys Lys Ala Glu Arg Glu Gly Cys Gln Tyr Ile Ser 435 440 445 Phe Lys Thr Asn Pro Asn Ser Met Val Ser His Ile Ala Gly Lys Ser 450 455 460 Ser Ile Leu Arg Ala Leu Pro Ile Asp Val Leu Ala Asn Ala Tyr Arg 465 470 475 480 Ile Ser Arg Gln Glu Ala Arg Asn Leu Lys Asn Asn Arg Gly Glu Glu 485 490 495 Phe Gly Ala Phe Thr Pro Lys Leu Thr Gln Lys Gly Phe Gln Ser Tyr 500 505 510 Gln Asp Ile Glu Glu Gly Ser Ser Ser Pro Val Arg Ala Ser Glu 515 520 525 <210> SEQ ID NO 255 <211> LENGTH: 498 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 255 Met Ala Ser Thr Asn Arg Pro Ile Val Phe Phe Thr Val Cys Leu Phe 1 5 10 15 Leu Leu Cys Asp Gly Ser Leu Ala Gln Gln Leu Leu Gly Gln Ser Thr 20 25 30 Ser Gln Trp Gln Ser Ser Arg Arg Gly Ser Pro Arg Gly Cys Arg Phe 35 40 45 Asp Arg Leu Gln Ala Phe Glu Pro Ile Arg Ser Val Arg Ser Gln Ala 50 55 60 Gly Thr Thr Glu Phe Phe Asp Val Ser Asn Glu Leu Phe Gln Cys Thr 65 70 75 80 Gly Val Ser Val Val Arg Arg Val Ile Glu Pro Arg Gly Leu Leu Leu 85 90 95 Pro His Tyr Thr Asn Gly Ala Ser Leu Val Tyr Ile Ile Gln Gly Arg 100 105 110 Gly Ile Thr Gly Pro Thr Phe Pro Gly Cys Pro Glu Thr Tyr Gln Gln 115 120 125 Gln Phe Gln Gln Ser Gly Gln Ala Gly Leu Thr Glu Ser Gln Ser Gln 130 135 140 Ser His Lys Phe Lys Asp Glu His Gln Lys Ile His Arg Phe Arg Gln 145 150 155 160 Gly Asp Val Ile Ala Leu Pro Ala Gly Val Ala His Trp Cys Tyr Asn 165 170 175 Asp Cys Glu Val Pro Val Val Ala Ile Tyr Val Thr Asp Ile Asn Asn 180 185 190 Gly Ala Asn Gln Leu Asp Pro Arg Gln Arg Asp Phe Leu Leu Ala Gly 195 200 205 Asn Lys Arg Asn Pro Gln Ala Tyr Arg Arg Glu Val Glu Glu Trp Ser 210 215 220 Gln Asn Ile Phe Ser Gly Phe Ser Thr Glu Leu Leu Ser Glu Ala Phe 225 230 235 240 Gly Ile Ser Asn Gln Val Ala Arg Gln Leu Gln Cys Gln Asn Asp Gln 245 250 255 Lys Gly Glu Ile Val Arg Val Glu Arg Gly Leu Ser Leu Leu Gln Pro 260 265 270 Tyr Ala Ser Leu Gln Glu Gln Glu Gln Gly Gln Met Gln Ser Arg Glu 275 280 285 His Tyr Gln Glu Gly Gly Tyr Gln Gln Ser Gln Tyr Gly Ser Gly Cys 290 295 300 Pro Asn Gly Leu Asp Glu Thr Phe Cys Val Asn Lys Val Arg Gln Asn 305 310 315 320 Ile Asp Asn Pro Asn Arg Ala Asp Thr Tyr Asn Pro Arg Ala Gly Arg 325 330 335 Val Thr Asn Leu Ser Gln Asn Phe Pro Ile Leu Asn Leu Val Gln Met 340 345 350 Ser Ala Val Lys Val Asn Leu Tyr Gln Asn Thr Asp Thr Trp Ile Ser 355 360 365 Met Gly Gln Glu Glu Asn Ala Leu Leu Ser Pro Phe Trp Asn Ile Asn 370 375 380 Ala His Ser Ile Val Tyr Ile Thr Gln Gly Arg Ala Gln Val Gln Val 385 390 395 400 Leu Arg Arg Gly Gln Leu Leu Ile Val Pro Gln His Tyr Val Val Val 405 410 415 Lys Lys Ala Gln Arg Glu Gly Cys Ala Tyr Ile Ala Phe Lys Thr Asn 420 425 430 Pro Asn Ser Met Val Ser His Ile Ala Gly Lys Ser Ser Ile Phe Arg 435 440 445 Ala Leu Pro Thr Asp Val Leu Ala Asn Ala Tyr Arg Ile Ser Arg Glu 450 455 460 Glu Ala Gln Arg Leu Lys His Asn Arg Gly Asp Glu Phe Gly Ala Phe 465 470 475 480 Thr Pro Leu Gln Tyr Lys Ser Tyr Gln Asp Val Tyr Asn Val Ala Glu 485 490 495 Ser Ser

<210> SEQ ID NO 256 <211> LENGTH: 491 <212> TYPE: PRT <213> ORGANISM: Oryza brachyantha <400> SEQUENCE: 256 Met Lys Ser Ser Ile Val Phe Ser Thr Ile Cys Leu Val Leu Leu Cys 1 5 10 15 His Gly Ser Leu Ala Gln Leu Leu Ser Gln Ser Thr Ser Gln Trp Gln 20 25 30 Ser Ser Arg Arg Gly Ser Pro Arg Gln Cys Arg Phe Asp Gln Leu Gln 35 40 45 Ala Phe Glu Pro Ile Arg Thr Val Arg Ser Gln Ala Gly Val Thr Glu 50 55 60 Phe Tyr Asp Val Ser Asn Glu Leu Phe Gln Cys Thr Gly Val Ser Val 65 70 75 80 Val Arg Arg Val Ile Glu Pro Arg Gly Leu Leu Leu Pro His Tyr Ser 85 90 95 Asn Gly Ala Thr Leu Val Tyr Ile Ile Gln Gly Arg Gly Ile Thr Gly 100 105 110 Pro Thr Phe Pro Gly Cys Pro Glu Thr Tyr Gln Gln Gln Phe Gln Gln 115 120 125 Ser Gly Glu Ala Gln Pro Phe Glu Gly Gln Ser His Lys Phe Arg Asp 130 135 140 Glu His Gln Lys Ile His Arg Phe Arg Gln Gly Asp Val Val Ala Leu 145 150 155 160 Pro Ala Gly Val Ala His Trp Cys Tyr Asn Asp Gly Glu Val Pro Ile 165 170 175 Val Ala Ile Tyr Val Thr Asp Ile Tyr Asn Ser Ala Asn Gln Leu Asp 180 185 190 Pro Arg His Arg Asp Phe Phe Leu Ala Gly Asn Asn Lys Val Ala Gln 195 200 205 Gln Leu Tyr Arg Ser Glu Ala Arg Glu Asn Ser Lys Asn Ile Phe Gly 210 215 220 Gly Phe Ser Val Glu Leu Leu Ser Glu Ala Leu Gly Ile Ser Arg Gly 225 230 235 240 Val Ala Arg Gln Leu Gln Cys Gln Asn Asp Gln Arg Gly Glu Ile Val 245 250 255 Arg Val Glu His Gly Leu Ala Leu Leu Gln Pro Tyr Ala Ser Val Gln 260 265 270 Glu Gln Gln Gln Glu Gln Val Gln Ser Arg Asp Tyr Glu Gln Thr Gln 275 280 285 Tyr Gln Gln Lys Gln Pro Gln Gly Ser Cys Ser Asn Gly Leu Asp Glu 290 295 300 Thr Phe Cys Thr Met Arg Leu Arg Gln Asn Ile Asp Asn Pro Asn Leu 305 310 315 320 Ala Asp Thr Tyr Asn Pro Lys Ala Gly Arg Ile Thr Tyr Leu Asn Gly 325 330 335 Gln Lys Phe Pro Ile Leu Asn Leu Val Gln Met Ser Ala Val Lys Val 340 345 350 Asn Leu Tyr Gln Asn Ala Val Leu Ser Pro Phe Trp Asn Ile Asn Ala 355 360 365 His Ser Val Val Tyr Ile Thr Gln Gly Arg Ala Arg Val Gln Val Val 370 375 380 Asn Asn Asn Gly Lys Thr Val Phe Asp Gly Glu Leu Arg Gln Gly Gln 385 390 395 400 Leu Leu Ile Ile Pro Gln His His Val Val Leu Lys Lys Ala Gln Arg 405 410 415 Glu Gly Cys Ser Tyr Ile Ala Leu Lys Thr Asn Pro Asn Ser Ile Val 420 425 430 Ser His Ile Ala Gly Lys Asn Ser Ile Phe Arg Ala Leu Pro Gly Asp 435 440 445 Val Val Thr Asn Ala Tyr Arg Ile Ser Arg Glu Glu Ala Lys Arg Ile 450 455 460 Lys His Asn Arg Gly Asp Glu Ser Gly Val Phe Ala Pro Ser His Ala 465 470 475 480 Tyr Arg Ser Tyr Gln Asp Met Ser Val Ala Ala 485 490 <210> SEQ ID NO 257 <211> LENGTH: 492 <212> TYPE: PRT <213> ORGANISM: Brachypodium distachyon <400> SEQUENCE: 257 Met Ala His Thr Ser Phe Ser Ser Phe Leu Ser Tyr Phe Cys Leu Phe 1 5 10 15 Leu Leu Phe His Gly Ser Met Ala Gln Val Leu Gly Gln Val Ser Thr 20 25 30 Trp Gln Ser Ser Arg Gln Gly Gly Ser Arg Asp Cys Ser Phe Asp Arg 35 40 45 Leu Gln Ala Ile Glu Pro Val Thr Gln Val Arg Ser Gln Ala Gly Leu 50 55 60 Thr Glu Tyr Phe Asp Glu Gln Asn Glu Gln Phe Arg Cys Ala Gly Val 65 70 75 80 Phe Val Ile Arg Arg Val Ile Glu Pro Arg Gly Leu Leu Leu Pro Arg 85 90 95 Tyr His Asn Thr Pro Gly Leu Val Tyr Ile Leu Gln Gly Asn Gly Phe 100 105 110 Val Gly Leu Thr Phe Pro Gly Cys Pro Glu Thr Phe Arg Glu Gln Phe 115 120 125 Gln Gln Phe Arg Gln Thr Gln Ser Thr Leu Gly Gln Ser Gln Cys Gln 130 135 140 Ser Gln Lys Leu Gly Asp Val His Gln Arg Val His Gln Phe Thr Gln 145 150 155 160 Gly Asp Val Val Ala Leu Pro Thr Gly Val Ala His Trp Ile Tyr Asn 165 170 175 Gly Gly Asp Ala Pro Val Val Ile Val Tyr Val Phe Asp Val Asn Asn 180 185 190 Asn Ala Asn Gln Leu Glu Pro Arg Gln Lys Glu Phe Leu Leu Gly Gly 195 200 205 Asn Tyr Asn Gly Val Leu Gln Tyr Gly Gln Asn Ile Phe Ser Gly Phe 210 215 220 Asn Ala Gln Leu Leu Ser Gln Ala Phe Gly Ile Asn Glu Gln Thr Ser 225 230 235 240 Gln Arg Ile Gln Asn Gln Asn Asp Gly Arg Gly Asp Ile Ile Arg Val 245 250 255 Asp Asn Gly Leu Gln Phe Leu Lys Pro Val Val Thr Gln Gln Gln Pro 260 265 270 Glu Gln Pro Phe Met Pro Ile Gln His Gln Thr Gly Gln Ser Ser Arg 275 280 285 Asn Gly Leu Glu Glu Asn Phe Cys Ser Leu Glu Pro Arg Gln Asn Ile 290 295 300 Glu Asp Pro Asn Arg Ala Asp Thr Tyr Asn Pro Arg Ala Gly Ser Ile 305 310 315 320 Thr Arg Leu Asn Gly Gln Asn Phe Pro Ile Leu Asn Leu Val Gln Met 325 330 335 Ser Ala Thr Arg Val Asn Leu Gln Lys Asn Ala Ile Leu Ser Pro Phe 340 345 350 Trp Asn Ile Asn Ala His Ser Val Val Tyr Val Ile Gln Gly His Ala 355 360 365 Leu Val Gln Val Val Asn Asn Gln Gly His Asn Val Phe Asn Gly Leu 370 375 380 Leu His Arg Gly Gln Leu Leu Ile Ile Pro Gln Asn Tyr Val Val Leu 385 390 395 400 Lys Lys Ala Glu Ser Glu Gly Tyr Gln Tyr Ile Ala Phe Lys Thr Asn 405 410 415 Ala Asn Ser Met Val Ser His Ile Ala Gly Lys Asn Ser Ile Leu Arg 420 425 430 Ala Leu Pro Val Asp Val Ile Ala Asn Ala Tyr Arg Ile Ser Arg Gln 435 440 445 Glu Ala Gln Asn Leu Lys Asn Asn Arg Gly Glu Glu Thr Gly Val Leu 450 455 460 Thr Pro Asn Phe Ser Gln Ser Thr Cys Gln Ser Tyr Gln Thr Glu Asp 465 470 475 480 Val Gln Ser Leu Arg Pro Met Ser His Trp Ser Glu 485 490 <210> SEQ ID NO 258 <211> LENGTH: 166 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <220> FEATURE: <221> NAME/KEY: misc_feature <222> LOCATION: (120)..(120) <223> OTHER INFORMATION: Xaa can be any naturally occurring amino acid <400> SEQUENCE: 258 Met Ala Ser Asn Lys Val Val Phe Ser Ala Leu Leu Leu Ile Ile Val 1 5 10 15 Ser Val Leu Ala Ala Thr Ala Thr Met Ala Asp His His Lys Asp Gln 20 25 30 Val Val Tyr Ser Leu Gly Glu Arg Cys Gln Pro Gly Met Gly Tyr Pro 35 40 45 Met Tyr Ser Leu Pro Arg Cys Arg Ala Val Val Lys Arg Gln Cys Val 50 55 60 Gly His Gly Ala Pro Gly Gly Ala Val Asp Glu Gln Leu Arg Gln Asp 65 70 75 80 Cys Cys Arg Gln Leu Ala Ala Val Asp Asp Ser Trp Cys Arg Cys Ser 85 90 95 Ala Leu Asn His Met Val Gly Gly Ile Tyr Arg Glu Leu Gly Ala Thr 100 105 110 Asp Val Gly His Pro Met Ala Xaa Val Phe Pro Gly Cys Arg Arg Gly 115 120 125 Asp Leu Glu Arg Ala Ala Ala Ser Leu Pro Ala Phe Cys Asn Val Asp 130 135 140 Ile Pro Asn Gly Thr Gly Gly Val Cys Tyr Trp Leu Gly Tyr Pro Arg 145 150 155 160 Thr Pro Arg Thr Gly His 165 <210> SEQ ID NO 259

<211> LENGTH: 165 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 259 Met Ala Ser Asn Lys Val Val Phe Ser Ala Leu Leu Leu Ile Ile Val 1 5 10 15 Ser Val Leu Arg Arg Asp Gly Thr Met Ala Asp His His Lys Asp Gln 20 25 30 Val Val Tyr Ser Leu Gly Glu Arg Cys Gln Pro Gly Met Gly Tyr Pro 35 40 45 Met Tyr Ser Leu Pro Arg Cys Arg Ala Val Val Lys Arg Gln Cys Val 50 55 60 Gly His Gly Ala Pro Gly Ala Val Asp Glu Gln Leu Arg Gln Asp Cys 65 70 75 80 Cys Arg Gln Leu Ala Ala Val Asp Asp Ser Trp Cys Arg Cys Ser Ala 85 90 95 Leu Asn His Met Val Gly Gly Ile Tyr Arg Glu Leu Gly Ala Thr Asp 100 105 110 Val Gly His Pro Met Ala Glu Val Phe Pro Gly Cys Arg Arg Gly Asp 115 120 125 Leu Glu Arg Ala Ala Ala Ser Leu Pro Ala Phe Cys Asn Val Asp Ile 130 135 140 Pro Asn Gly Thr Gly Gly Val Cys Tyr Trp Leu Gly Tyr Pro Arg Thr 145 150 155 160 Pro Arg Thr Gly His 165 <210> SEQ ID NO 260 <211> LENGTH: 157 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 260 Met Ala Ser Asn Lys Val Val Ile Ser Ala Leu Leu Val Val Val Val 1 5 10 15 Ser Val Leu Ala Ala Thr Thr Thr Met Ala Asp His His Gln Glu Gln 20 25 30 Val Val Tyr Thr Pro Gly Gln Leu Cys Gln Pro Gly Ile Gly Tyr Pro 35 40 45 Thr Tyr Pro Leu Pro Arg Cys Arg Ala Phe Val Lys Arg Gln Cys Val 50 55 60 Ala Pro Gly Thr Val Asp Glu Gln Val Arg Arg Gly Cys Cys Arg Gln 65 70 75 80 Leu Ala Ala Ile Asp Ser Ser Trp Cys Arg Cys Asp Ala Leu Asn His 85 90 95 Met Leu Arg Ile Ile Tyr Arg Glu Ser Gly Ala Ala Asp Ala Gly His 100 105 110 Pro Met Ala Glu Val Phe Arg Gly Cys Arg Arg Gly Asp Ile Glu Arg 115 120 125 Ala Ala Ala Ser Leu Pro Ala Phe Cys Asn Val Asp Ile Pro Asn Gly 130 135 140 Val Gly Gly Val Cys Tyr Trp Leu Pro Gly Thr Gly Tyr 145 150 155 <210> SEQ ID NO 261 <211> LENGTH: 495 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 261 Met Thr Ile Ser Val Phe Ser Arg Phe Ser Ile Tyr Phe Cys Val Leu 1 5 10 15 Leu Leu Cys Asn Gly Ser Met Ala Gln Leu Phe Asp Pro Ala Thr Asn 20 25 30 Gln Trp Gln Thr His Arg Gln Gly Ser Phe Arg Glu Cys Arg Phe Glu 35 40 45 Arg Leu Gln Ala Phe Glu Pro Leu Gln Asn Val Arg Ser Glu Ala Gly 50 55 60 Val Thr Glu Tyr Phe Asp Glu Thr Asn Glu Leu Phe Gln Cys Thr Gly 65 70 75 80 Thr Phe Val Ile Arg Arg Val Ile Gln Pro Gln Gly Leu Leu Ile Pro 85 90 95 Arg Tyr Ala Asn Thr Pro Gly Met Val Tyr Ile Ile Gln Gly Arg Gly 100 105 110 Ser Met Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Tyr Gln Gln Gln 115 120 125 Ser Gln Gln Phe Leu Phe Gln Gly Glu Ser Gln Ser Gln Lys Phe Ile 130 135 140 Asp Glu His Gln Lys Ile His Gln Phe Arg Gln Gly Asp Ile Val Val 145 150 155 160 Leu Pro Thr Gly Val Ala His Trp Phe Tyr Asn Asp Gly Asp Thr Pro 165 170 175 Val Val Ala Leu Tyr Val Tyr Asp Ile Asn Asn Ser Ala Asn Gln Leu 180 185 190 Glu Pro Arg His Arg Glu Phe Leu Leu Ala Gly Lys Asn Asn Arg Val 195 200 205 Gln Gln Val Tyr Gly Arg Ser Ile Gln Gln His Ser Gly Gln Asn Ile 210 215 220 Phe Asn Gly Phe Ser Val Glu Pro Leu Ser Glu Ala Leu Asn Ile Asn 225 230 235 240 Thr Val Thr Thr Lys Arg Leu Gln Ser Gln Asn Asp Gln Arg Gly Glu 245 250 255 Ile Ile His Val Lys Asn Gly Leu Gln Leu Leu Lys Pro Thr Leu Thr 260 265 270 Gln Arg Gln Glu Gln Glu Gln Ala Gln Tyr Gln Glu Val Gln Tyr Ser 275 280 285 Glu Lys Pro Gln Thr Ser Ser Arg Trp Asn Gly Leu Glu Glu Asn Leu 290 295 300 Cys Thr Ile Lys Thr Arg Leu Asn Ile Glu Asn Pro Ser Arg Ala Asp 305 310 315 320 Ser Tyr Asp Pro Arg Ala Gly Arg Ile Thr Ser Leu Asp Ser Gln Lys 325 330 335 Phe Pro Ile Leu Asn Ile Ile Gln Met Ser Ala Thr Arg Val Asn Leu 340 345 350 Tyr Gln Asn Ala Ile Leu Thr Pro Phe Trp Asn Val Asn Ala His Ser 355 360 365 Leu Met Tyr Val Ile Arg Gly Arg Ala Arg Val Gln Val Val Ser Asn 370 375 380 Phe Gly Lys Thr Val Phe Asp Gly Val Leu Arg Pro Glu Gln Leu Leu 385 390 395 400 Ile Ile Pro Gln Asn Tyr Val Val Leu Lys Lys Ala Gln His Glu Gly 405 410 415 Cys Gln Tyr Ile Ala Ile Asn Thr Asn Ala Asn Ala Phe Val Ser His 420 425 430 Leu Ala Gly Val Asp Ser Val Phe His Ala Leu Pro Val Asp Val Ile 435 440 445 Ala Asn Ala Tyr Cys Ile Ser Arg Glu Glu Ala Arg Arg Leu Lys Asn 450 455 460 Asn Arg Gly Asp Glu Tyr Gly Pro Phe Pro Pro Arg Leu Gln Gln Gln 465 470 475 480 Ile Tyr Pro Glu Phe Ser Asn Glu Ser Lys Gly Glu Thr Ser Glu 485 490 495 <210> SEQ ID NO 262 <211> LENGTH: 480 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 262 Leu Leu Cys His Gly Ser Met Ala Gln Ile Phe Ser Leu Gly Ile Asn 1 5 10 15 Pro Trp Gln Asn Pro Arg Gln Gly Gly Ser Arg Glu Cys Arg Phe Asp 20 25 30 Arg Leu Gln Ala Phe Glu Pro Leu Arg Lys Val Arg His Glu Ala Gly 35 40 45 Val Thr Glu Tyr Phe Asp Glu Lys Asn Glu Gln Phe Gln Cys Thr Gly 50 55 60 Thr Leu Val Ile Arg Arg Ile Ile Glu Pro Gln Gly Leu Leu Leu Pro 65 70 75 80 Arg Tyr Ser Asn Thr Pro Gly Leu Val Tyr Ile Ile Gln Gly Thr Gly 85 90 95 Val Leu Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Tyr Gln Lys Gln 100 105 110 Phe Arg His Phe Gly Leu Glu Gly Gly Ser Gln Arg Gln Gly Lys Lys 115 120 125 Leu Arg Asp Glu Asn Gln Lys Ile His Gln Phe Arg Gln Gly Asp Val 130 135 140 Val Ala Leu Pro Ser Gly Ile Pro His Trp Phe Tyr Asn Glu Gly Asp 145 150 155 160 Thr Pro Val Val Ala Leu Phe Val Phe Asp Val Asn Asn Asn Ala Asn 165 170 175 Gln Leu Glu Pro Arg Gln Lys Glu Phe Leu Leu Ala Gly Asn Asn Ile 180 185 190 Glu Gln Gln Val Ser Asn Pro Ser Ile Asn Lys His Ser Gly Gln Asn 195 200 205 Ile Phe Asn Gly Phe Asn Thr Lys Leu Leu Ser Glu Ala Leu Gly Val 210 215 220 Asn Ile Glu Val Thr Arg Arg Leu Gln Ser Gln Asn Asp Arg Arg Gly 225 230 235 240 Asp Ile Ile Arg Val Lys Asn Gly Leu Arg Leu Ile Lys Pro Thr Ile 245 250 255 Thr Gln Gln Gln Glu Gln Thr Gln Asp Gln Tyr Gln Gln Ile Gln Tyr 260 265 270 His Arg Glu Gln Arg Ser Thr Ser Lys Tyr Asn Gly Leu Asp Glu Asn 275 280 285 Phe Cys Ala Ile Arg Ala Arg Leu Asn Ile Glu Asn Pro Asn His Ala 290 295 300 Asp Thr Tyr Asn Pro Arg Ala Gly Arg Ile Thr Asn Leu Asn Ser Gln 305 310 315 320 Lys Phe Ser Ile Leu Asn Leu Val Gln Met Ser Ala Thr Arg Val Asn 325 330 335 Leu Tyr Gln Asn Ala Ile Leu Ser Pro Phe Trp Asn Ile Asn Ala His 340 345 350

Ser Leu Val Tyr Thr Ile Gln Gly Arg Ala Arg Val Gln Val Val Ser 355 360 365 Asn His Gly Lys Ala Val Phe Asn Gly Val Leu Arg Pro Gly Gln Leu 370 375 380 Leu Ile Ile Pro Gln Asn Tyr Val Val Met Lys Lys Ala Glu Leu Glu 385 390 395 400 Gly Phe Gln Phe Ile Ala Phe Lys Thr Asn Pro Asn Ala Met Val Asn 405 410 415 His Ile Ala Gly Lys Asn Ser Val Leu Arg Ala Met Pro Val Asp Val 420 425 430 Ile Ala Asn Ala Tyr Arg Ile Ser Arg Gln Glu Ala Arg Ser Leu Lys 435 440 445 Asn Asn Arg Gly Glu Glu Ile Gly Ala Phe Thr Pro Arg Tyr Gln Gln 450 455 460 Gln Lys Ile His Gln Glu Tyr Ser Asn Pro Asn Glu Ser Glu Thr Gln 465 470 475 480 <210> SEQ ID NO 263 <211> LENGTH: 518 <212> TYPE: PRT <213> ORGANISM: Avena sativa <400> SEQUENCE: 263 Met Ala Thr Thr Arg Phe Pro Ser Leu Leu Phe Tyr Ser Cys Ile Phe 1 5 10 15 Leu Leu Cys Asn Gly Ser Met Ala Gln Leu Phe Gly Gln Ser Phe Thr 20 25 30 Pro Trp Gln Ser Ser Arg Gln Gly Gly Leu Arg Gly Cys Arg Phe Asp 35 40 45 Arg Leu Gln Ala Phe Glu Pro Leu Arg Gln Val Arg Ser Gln Ala Gly 50 55 60 Ile Thr Glu Tyr Phe Asp Glu Gln Asn Glu Gln Phe Arg Cys Ala Gly 65 70 75 80 Val Ser Val Ile Arg Arg Val Ile Glu Pro Gln Gly Leu Leu Leu Pro 85 90 95 Gln Tyr His Asn Ala Pro Gly Leu Val Tyr Ile Leu Gln Gly Arg Gly 100 105 110 Phe Thr Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Phe Gln Gln Gln 115 120 125 Phe Gln Pro Phe Asp Gln Ala Arg Phe Ala Gln Gly Gln Ser Lys Ser 130 135 140 Gln Asn Leu Lys Asp Glu His Gln Arg Val His His Ile Lys Gln Gly 145 150 155 160 Asp Val Val Ala Leu Pro Ala Gly Ile Val His Trp Cys Tyr Asn Asp 165 170 175 Gly Asp Ala Pro Ile Val Ala Val Tyr Val Phe Asp Val Asn Asn Asn 180 185 190 Ala Asn Gln Leu Glu Pro Arg Gln Lys Glu Phe Leu Leu Ala Gly Asn 195 200 205 Asn Lys Arg Glu Gln Gln Phe Gly Gln Asn Ile Phe Ser Gly Phe Ser 210 215 220 Val Gln Leu Leu Ser Glu Ala Leu Gly Ile Ser Gln Gln Ala Ala Gln 225 230 235 240 Lys Ile Gln Ser Gln Asn Asp Gln Arg Gly Glu Ile Ile Arg Val Ser 245 250 255 Gln Gly Leu Gln Phe Leu Lys Pro Phe Val Ser Gln Gln Gly Pro Val 260 265 270 Glu His Gln Ala Tyr Gln Pro Ile Gln Ser Gln Gln Glu Gln Ser Thr 275 280 285 Gln Tyr Gln Val Gly Gln Ser Pro Gln Tyr Gln Glu Gly Gln Ser Thr 290 295 300 Gln Tyr Gln Ser Gly Gln Ser Trp Asp Gln Ser Phe Asn Gly Leu Glu 305 310 315 320 Glu Asn Phe Cys Ser Leu Glu Ala Arg Gln Asn Ile Glu Asn Pro Lys 325 330 335 Arg Ala Asp Thr Tyr Asn Pro Arg Ala Gly Arg Ile Thr His Leu Asn 340 345 350 Ser Lys Asn Phe Pro Thr Leu Asn Leu Val Gln Met Ser Ala Thr Arg 355 360 365 Val Asn Leu Tyr Gln Asn Ala Ile Leu Ser Pro Tyr Trp Asn Ile Asn 370 375 380 Ala His Ser Val Met His Met Ile Gln Gly Arg Ala Arg Val Gln Val 385 390 395 400 Val Asn Asn His Gly Gln Thr Val Phe Asn Asp Ile Leu Arg Arg Gly 405 410 415 Gln Leu Leu Ile Ile Pro Gln His Tyr Val Val Leu Lys Lys Ala Glu 420 425 430 Arg Glu Gly Cys Gln Tyr Ile Ser Phe Lys Thr Thr Pro Asn Ser Met 435 440 445 Val Ser Tyr Ile Ala Gly Lys Thr Ser Ile Leu Arg Ala Leu Pro Val 450 455 460 Asp Val Leu Ala Asn Ala Tyr Arg Ile Ser Arg Gln Glu Ser Gln Asn 465 470 475 480 Leu Lys Asn Asn Arg Gly Glu Glu Phe Gly Ala Phe Thr Pro Lys Phe 485 490 495 Ala Gln Thr Gly Ser Gln Ser Tyr Gln Asp Glu Gly Glu Ser Ser Ser 500 505 510 Thr Glu Lys Ala Ser Glu 515 <210> SEQ ID NO 264 <211> LENGTH: 605 <212> TYPE: PRT <213> ORGANISM: Oryza rufipogon <400> SEQUENCE: 264 Met Ser Ala Leu Thr Thr Ser Gln Leu Ala Thr Ser Ala Thr Gly Phe 1 5 10 15 Gly Ile Ala Asp Arg Ser Ala Pro Ser Ser Leu Leu Arg His Gly Phe 20 25 30 Gln Gly Leu Lys Pro Arg Ser Pro Ala Gly Gly Asp Ala Thr Ser Leu 35 40 45 Ser Val Thr Thr Ser Ala Arg Ala Thr Pro Lys Gln Gln Arg Ser Val 50 55 60 Gln Arg Gly Ser Arg Arg Phe Pro Ser Val Val Val Tyr Ala Thr Gly 65 70 75 80 Ala Gly Met Asn Val Val Phe Val Gly Ala Glu Met Ala Pro Trp Ser 85 90 95 Lys Thr Gly Gly Leu Gly Asp Val Leu Gly Gly Leu Pro Pro Ala Met 100 105 110 Ala Ala Asn Gly His Arg Val Met Val Ile Ser Pro Arg Tyr Asp Gln 115 120 125 Tyr Lys Asp Ala Trp Asp Thr Ser Val Val Ala Glu Ile Lys Val Ala 130 135 140 Asp Arg Tyr Glu Arg Val Arg Phe Phe His Cys Tyr Lys Arg Gly Val 145 150 155 160 Asp Arg Val Phe Val Asp His Pro Ser Phe Leu Glu Lys Val Trp Gly 165 170 175 Lys Thr Gly Glu Lys Ile Tyr Gly Pro Asp Thr Gly Val Asp Tyr Lys 180 185 190 Asp Asn Gln Met Arg Phe Ser Leu Leu Cys Gln Ala Pro Arg Ile Leu 195 200 205 Asn Leu Asn Asn Asn Pro Tyr Phe Lys Gly Thr Tyr Gly Glu Asp Val 210 215 220 Val Phe Val Cys Asn Asp Trp His Thr Gly Pro Leu Ala Ser Tyr Leu 225 230 235 240 Lys Asn Asn Tyr Gln Pro Asn Gly Ile Tyr Arg Asn Ala Lys Val Ala 245 250 255 Phe Cys Ile His Asn Ile Ser Tyr Gln Gly Arg Phe Ala Phe Glu Asp 260 265 270 Tyr Pro Glu Leu Asn Leu Ser Glu Arg Phe Arg Ser Ser Phe Asp Phe 275 280 285 Ile Asp Gly Tyr Asp Thr Pro Val Glu Gly Arg Lys Ile Asn Trp Met 290 295 300 Lys Ala Gly Ile Leu Glu Ala Asp Arg Val Leu Thr Val Ser Pro Tyr 305 310 315 320 Tyr Ala Glu Glu Leu Ile Ser Gly Ile Ala Arg Gly Cys Glu Leu Asp 325 330 335 Asn Ile Met Arg Leu Thr Gly Ile Thr Gly Ile Val Asn Gly Met Asp 340 345 350 Val Ser Glu Trp Asp Pro Ser Lys Asp Lys Tyr Ile Thr Ala Lys Tyr 355 360 365 Asp Ala Thr Thr Ala Ile Glu Ala Lys Ala Leu Asn Lys Glu Ala Leu 370 375 380 Gln Ala Glu Ala Gly Leu Pro Val Asp Arg Lys Ile Pro Leu Ile Ala 385 390 395 400 Phe Ile Gly Arg Leu Glu Glu Gln Lys Gly Pro Asp Val Met Ala Ala 405 410 415 Ala Ile Pro Glu Leu Met Gln Glu Asp Val Gln Ile Val Leu Leu Gly 420 425 430 Thr Gly Lys Lys Lys Phe Glu Lys Leu Leu Lys Ser Met Glu Glu Lys 435 440 445 Tyr Pro Gly Lys Val Arg Ala Val Val Lys Phe Asn Ala Pro Leu Ala 450 455 460 His Leu Ile Met Ala Gly Ala Asp Val Leu Ala Val Pro Ser Arg Phe 465 470 475 480 Glu Pro Cys Gly Leu Ile Gln Leu Gln Gly Met Arg Tyr Gly Thr Pro 485 490 495 Cys Ala Cys Ala Ser Thr Gly Gly Leu Val Asp Thr Val Ile Glu Gly 500 505 510 Lys Thr Gly Phe His Met Gly Arg Leu Ser Val Asp Cys Lys Val Val 515 520 525 Glu Pro Ser Asp Val Lys Lys Val Ala Ala Thr Leu Lys Arg Ala Ile 530 535 540 Lys Val Val Gly Thr Pro Ala Tyr Glu Glu Met Val Arg Asn Cys Met 545 550 555 560 Asn Gln Asp Leu Ser Trp Lys Gly Pro Ala Lys Asn Trp Glu Asn Val 565 570 575 Leu Leu Gly Leu Gly Val Ala Gly Ser Ala Pro Gly Ile Glu Gly Asp 580 585 590

Glu Ile Ala Pro Leu Ala Lys Glu Asn Val Ala Ala Pro 595 600 605 <210> SEQ ID NO 265 <211> LENGTH: 609 <212> TYPE: PRT <213> ORGANISM: ORYZA OFFICINALIS <400> SEQUENCE: 265 Met Ser Ala Leu Thr Thr Ser Gln Leu Ala Thr Ser Ala Thr Gly Phe 1 5 10 15 Gly Ile Ala Asp Arg Ser Ala Pro Ser Ser Leu Leu Arg His Gly Phe 20 25 30 Gln Gly Leu Lys Pro Arg Ser Pro Ala Gly Gly Asp Ala Ser Ser Leu 35 40 45 Ser Val Thr Thr Ser Ala Arg Ala Thr Pro Lys Gln Gln Arg Ser Val 50 55 60 Gln Arg Gly Ser Arg Arg Phe Pro Ser Val Val Val Tyr Ala Thr Gly 65 70 75 80 Ala Gly Met Asn Val Val Phe Val Gly Ala Glu Met Ala Pro Trp Ser 85 90 95 Lys Thr Gly Gly Leu Gly Asp Val Leu Gly Gly Leu Pro Pro Ala Met 100 105 110 Ala Ala Asn Gly His Arg Val Met Val Ile Ser Pro Arg His Asp Gln 115 120 125 Tyr Lys Asp Ala Trp Asp Thr Ser Val Val Ala Glu Ile Lys Val Ala 130 135 140 Asp Arg Tyr Glu Arg Val Arg Phe Phe His Cys Tyr Lys Arg Gly Val 145 150 155 160 Asp Arg Val Phe Ile Asp His Pro Ser Phe Leu Glu Lys Val Trp Gly 165 170 175 Lys Thr Gly Glu Lys Ile Tyr Gly Pro Asp Thr Gly Val Asp Tyr Lys 180 185 190 Asp Asn Gln Met Arg Phe Ser Leu Leu Cys Gln Ala Ala Leu Glu Ala 195 200 205 Pro Arg Ile Leu Asn Leu Asn Asn Asn Pro Tyr Phe Lys Gly Thr Tyr 210 215 220 Gly Glu Asp Val Val Phe Val Cys Asn Asp Trp His Thr Gly Pro Leu 225 230 235 240 Pro Ser Tyr Leu Lys Asn Asn Tyr Gln Pro Asn Gly Ile Tyr Arg Asn 245 250 255 Ala Lys Val Ala Phe Cys Ile His Asn Ile Ser Tyr Gln Gly Arg Phe 260 265 270 Ala Phe Glu Asp Tyr Pro Glu Leu Asn Leu Ser Glu Arg Phe Arg Ser 275 280 285 Ser Phe Asp Phe Ile Asp Gly Tyr Asp Thr Pro Val Glu Gly Arg Lys 290 295 300 Ile Asn Trp Met Lys Ala Gly Ile Leu Glu Ser Asp Arg Val Leu Thr 305 310 315 320 Val Ser Pro Tyr Tyr Ala Glu Glu Leu Ile Ser Gly Ile Ala Arg Gly 325 330 335 Cys Glu Leu Asp Asn Ile Met Arg Leu Thr Gly Ile Thr Gly Ile Val 340 345 350 Asn Gly Met Asp Val Ser Glu Trp Asp Pro Ser Lys Asp Lys Tyr Ile 355 360 365 Ala Ala Lys Tyr Asp Ala Thr Thr Ala Ile Glu Ala Lys Ala Leu Asn 370 375 380 Lys Glu Ala Leu Gln Ala Glu Ala Gly Leu Pro Val Asp Arg Lys Ile 385 390 395 400 Pro Leu Ile Ala Phe Ile Gly Arg Leu Glu Glu Gln Lys Gly Pro Asp 405 410 415 Val Met Ala Ala Ala Ile Pro Glu Leu Met Gln Glu Asn Val Gln Ile 420 425 430 Val Leu Leu Gly Thr Gly Lys Lys Lys Phe Glu Lys Leu Leu Lys Ser 435 440 445 Met Glu Glu Lys Tyr Pro Gly Lys Val Arg Ala Val Val Lys Phe Asn 450 455 460 Ala Pro Leu Ala His Leu Ile Met Ala Gly Ala Asp Val Leu Ala Val 465 470 475 480 Pro Ser Arg Phe Glu Pro Cys Gly Leu Ile Gln Leu Gln Gly Met Arg 485 490 495 Tyr Gly Thr Pro Cys Ala Cys Ala Ser Thr Gly Gly Leu Val Asp Thr 500 505 510 Val Ile Glu Gly Lys Thr Gly Phe His Met Gly Arg Leu Ser Val Asp 515 520 525 Cys Lys Val Val Glu Pro Ser Asp Val Gln Lys Val Ala Thr Thr Leu 530 535 540 Lys Arg Ala Ile Lys Ile Val Gly Thr Pro Ala Tyr Asn Glu Met Val 545 550 555 560 Arg Asn Cys Met Asn Gln Asp Leu Ser Trp Lys Gly Pro Ala Lys Asn 565 570 575 Trp Glu Asn Val Leu Leu Gly Leu Gly Val Ala Gly Ser Ala Pro Gly 580 585 590 Val Glu Gly Glu Glu Ile Ala Pro Leu Ala Lys Glu Asn Val Ala Ala 595 600 605 Pro <210> SEQ ID NO 266 <211> LENGTH: 603 <212> TYPE: PRT <213> ORGANISM: Hordeum vulgare <400> SEQUENCE: 266 Met Ala Ala Leu Ala Thr Ser Gln Leu Ala Thr Ser Gly Thr Val Leu 1 5 10 15 Gly Val Thr Asp Arg Phe Arg Arg Pro Gly Phe Gln Gly Leu Arg Pro 20 25 30 Arg Asn Pro Ala Asp Ala Ala Leu Gly Met Arg Thr Ile Gly Ala Ser 35 40 45 Ala Ala Pro Lys Gln Ser Arg Lys Ala His Arg Gly Ser Arg Arg Cys 50 55 60 Leu Ser Val Val Val Arg Ala Thr Gly Ser Gly Met Asn Leu Val Phe 65 70 75 80 Val Gly Ala Glu Met Ala Pro Trp Ser Lys Thr Gly Gly Leu Gly Asp 85 90 95 Val Leu Gly Gly Leu Pro Pro Ala Met Ala Ala Asn Gly His Arg Val 100 105 110 Met Val Val Ser Pro Arg Tyr Asp Gln Tyr Lys Asp Ala Trp Asp Thr 115 120 125 Ser Val Ile Ser Glu Ile Lys Val Ala Asp Glu Tyr Glu Arg Val Arg 130 135 140 Phe Phe His Cys Tyr Lys Arg Gly Val Asp Arg Val Phe Ile Asp His 145 150 155 160 Pro Trp Phe Leu Glu Lys Val Arg Gly Lys Thr Lys Glu Lys Ile Tyr 165 170 175 Gly Pro Asp Ala Gly Thr Asp Tyr Glu Asp Asn Gln Gln Arg Phe Ser 180 185 190 Leu Leu Cys Gln Ala Ala Leu Glu Ala Pro Arg Ile Leu Asn Leu Asn 195 200 205 Asn Asn Pro Tyr Phe Ser Gly Pro Tyr Gly Glu Asp Val Val Phe Val 210 215 220 Cys Asn Asp Trp His Thr Gly Leu Leu Ala Cys Tyr Leu Lys Ser Asn 225 230 235 240 Tyr Gln Ser Asn Gly Ile Tyr Arg Thr Ala Lys Val Ala Phe Cys Ile 245 250 255 His Asn Ile Ser Tyr Gln Gly Arg Phe Ser Phe Asp Asp Phe Ala Gln 260 265 270 Leu Asn Leu Pro Asp Arg Phe Lys Ser Ser Phe Asp Phe Ile Asp Gly 275 280 285 Tyr Asp Lys Pro Val Glu Gly Arg Lys Ile Asn Trp Met Lys Ala Gly 290 295 300 Ile Leu Gln Ala Asp Lys Val Leu Thr Val Ser Pro Tyr Tyr Ala Glu 305 310 315 320 Glu Leu Ile Ser Asp Glu Ala Arg Gly Cys Glu Leu Asp Asn Ile Met 325 330 335 Arg Leu Thr Gly Ile Thr Gly Ile Val Asn Gly Met Asp Val Ser Glu 340 345 350 Trp Asp Pro Thr Lys Asp Lys Phe Leu Ala Val Asn Tyr Asp Ile Thr 355 360 365 Thr Ala Leu Glu Ala Lys Ala Leu Asn Lys Glu Ala Leu Gln Ala Glu 370 375 380 Val Gly Leu Pro Val Asp Arg Lys Val Pro Leu Val Ala Phe Ile Gly 385 390 395 400 Arg Leu Glu Glu Gln Lys Gly Pro Asp Val Met Ile Ala Ala Ile Pro 405 410 415 Glu Ile Leu Lys Glu Glu Asp Val Gln Ile Ile Leu Leu Gly Thr Gly 420 425 430 Lys Lys Lys Phe Glu Lys Leu Leu Lys Ser Met Glu Glu Lys Phe Pro 435 440 445 Gly Lys Val Arg Ala Val Val Arg Phe Asn Ala Pro Leu Ala His Gln 450 455 460 Met Met Ala Gly Ala Asp Leu Leu Ala Val Thr Ser Arg Phe Glu Pro 465 470 475 480 Cys Gly Leu Ile Gln Leu Gln Gly Met Arg Tyr Gly Thr Pro Cys Val 485 490 495 Cys Ala Ser Thr Gly Gly Leu Val Asp Thr Ile Val Glu Gly Lys Thr 500 505 510 Gly Phe His Met Gly Arg Leu Ser Val Asp Cys Asn Val Val Glu Pro 515 520 525 Ala Asp Val Lys Lys Val Ala Thr Thr Leu Lys Arg Ala Val Lys Val 530 535 540 Val Gly Thr Pro Ala Tyr Gln Glu Met Val Lys Asn Cys Met Ile Gln 545 550 555 560 Asp Leu Ser Trp Lys Gly Pro Ala Lys Asn Trp Glu Asp Val Leu Leu 565 570 575 Glu Leu Gly Val Glu Gly Ser Glu Pro Gly Ile Val Gly Glu Glu Ile 580 585 590 Ala Pro Leu Ala Met Glu Asn Val Ala Ala Pro 595 600 <210> SEQ ID NO 267

<211> LENGTH: 336 <212> TYPE: PRT <213> ORGANISM: Staphylococcus aureus <400> SEQUENCE: 267 Met Lys Gly Lys Phe Leu Lys Val Ser Ser Leu Phe Val Ala Thr Leu 1 5 10 15 Thr Thr Ala Thr Leu Val Ser Ser Pro Ala Ala Asn Ala Leu Ser Ser 20 25 30 Lys Ala Met Asp Asn His Pro Gln Gln Ser Gln Ser Ser Lys Gln Gln 35 40 45 Thr Pro Lys Ile Gln Lys Gly Gly Asn Leu Lys Pro Leu Glu Gln Arg 50 55 60 Glu His Ala Asn Val Ile Leu Pro Asn Asn Asp Arg His Gln Ile Thr 65 70 75 80 Asp Thr Thr Asn Gly His Tyr Ala Pro Val Thr Tyr Ile Gln Val Glu 85 90 95 Ala Pro Thr Gly Thr Phe Ile Ala Ser Gly Val Val Val Gly Lys Asp 100 105 110 Thr Leu Leu Thr Asn Lys His Val Val Asp Ala Thr His Gly Asp Pro 115 120 125 His Ala Leu Lys Ala Phe Pro Ser Ala Ile Asn Gln Asp Asn Tyr Pro 130 135 140 Asn Gly Gly Phe Thr Ala Glu Gln Ile Thr Lys Tyr Ser Gly Glu Gly 145 150 155 160 Asp Leu Ala Ile Val Lys Phe Ser Pro Asn Glu Gln Asn Lys His Ile 165 170 175 Gly Glu Val Val Lys Pro Ala Thr Met Ser Asn Asn Ala Glu Thr Gln 180 185 190 Val Asn Gln Asn Ile Thr Val Thr Gly Tyr Pro Gly Asp Lys Pro Val 195 200 205 Ala Thr Met Trp Glu Ser Lys Gly Lys Ile Thr Tyr Leu Lys Gly Glu 210 215 220 Ala Met Gln Tyr Asp Leu Ser Thr Thr Gly Gly Asn Ser Gly Ser Pro 225 230 235 240 Val Phe Asn Glu Lys Asn Glu Val Ile Gly Ile His Trp Gly Gly Val 245 250 255 Pro Asn Glu Phe Asn Gly Ala Val Phe Ile Asn Glu Asn Val Arg Asn 260 265 270 Phe Leu Lys Gln Asn Ile Glu Asp Ile His Phe Ala Asn Asp Asp Gln 275 280 285 Pro Asn Asn Pro Asp Asn Pro Asp Asn Pro Asn Asn Pro Asp Asn Pro 290 295 300 Asn Asn Pro Asp Glu Pro Asn Asn Pro Asp Asn Pro Asn Asn Pro Asp 305 310 315 320 Asn Pro Asp Asn Gly Asp Asn Asn Asn Ser Asp Asn Pro Asp Ala Ala 325 330 335 <210> SEQ ID NO 268 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 268 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Arg 1 5 10 <210> SEQ ID NO 269 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 269 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Asp Lys 1 5 10 <210> SEQ ID NO 270 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 270 Arg Gly Pro Gln Gln Phe Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 271 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 271 Lys Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 272 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 272 Arg Gly Pro Glu Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 273 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 273 Arg Gly Pro Gln Glu Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 274 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 274 Arg Gly Pro Gln Gln Tyr Ala Asp Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 275 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 275 Arg Gly Pro Gln Gln Tyr Ala Glu Tyr Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 276 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 276 Lys Gly Pro Glu Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 277 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 277 Lys Gly Pro Gln Glu Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 278 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 278 Lys Gly Pro Gln Gln Phe Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 279 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 279 Arg Gly Pro Glu Gln Phe Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 280 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 280 Lys Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Arg 1 5 10 <210> SEQ ID NO 281 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 281 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Asp Arg 1 5 10

<210> SEQ ID NO 282 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 282 Arg Gly Pro Gln Gln Tyr Ala Asp Trp Gln Ile Asn Asp Lys 1 5 10 <210> SEQ ID NO 283 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 283 Arg Gly Pro Gln Gln Phe Ala Glu Trp Gln Ile Asn Glu Arg 1 5 10 <210> SEQ ID NO 284 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 284 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Val Asn Glu Lys 1 5 10 <210> SEQ ID NO 285 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 285 Arg Gly Pro Gln Gln Phe Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 286 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 286 Lys Gly Pro Gln Gln Phe Ala Glu Trp Gln Ile Asn Glu Arg 1 5 10 <210> SEQ ID NO 287 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 287 Lys Gly Pro Gln Gln Phe Ala Glu Trp Gln Val Asn Glu Lys 1 5 10 <210> SEQ ID NO 288 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 288 Arg Gly Pro Gln Gln Phe Ala Glu Trp Gln Val Asn Asp Lys 1 5 10 <210> SEQ ID NO 289 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 289 Arg Gly Pro Gln Gln Tyr Ala Asp Trp Gln Ile Asn Asp Arg 1 5 10 <210> SEQ ID NO 290 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 290 Lys Gly Pro Gln Gln Tyr Ala Asp Trp Gln Ile Asn Asp Lys 1 5 10 <210> SEQ ID NO 291 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 291 Arg Gly Pro Gln Gln Phe Ala Asp Tyr Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 292 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 292 Arg Gly Pro Gln Gln Tyr Ala Arg Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 293 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 293 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Glu 1 5 10 <210> SEQ ID NO 294 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 294 His Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 295 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 295 Arg Gly Pro Tyr Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 296 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 296 Arg Gly Pro Gln Gln Tyr Met Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 297 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 297 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Cys Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 298 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 298 Arg Gly Pro Gln Pro Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 299 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 299 Arg Gly Gly Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Asp 1 5 10 <210> SEQ ID NO 300 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 300 Arg Gly Pro Gln Gln Tyr Ala Arg Trp Lys Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 301 <211> LENGTH: 14 <212> TYPE: PRT

<213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 301 Arg Gly Gly Gln Gln Tyr Ala Glu Thr Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 302 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 302 Arg Gly Pro Leu Gln Tyr Ala Glu Trp Gln Asn Asn Glu Lys 1 5 10 <210> SEQ ID NO 303 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 303 Glu Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Asp 1 5 10 <210> SEQ ID NO 304 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 304 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Leu Leu 1 5 10 <210> SEQ ID NO 305 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 305 Arg Gly Pro Gln Gln Gly Gly Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 306 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 306 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Gly Gly Gly 1 5 10 <210> SEQ ID NO 307 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 307 Arg Gly Pro Gln Gln Lys Tyr Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 308 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 308 Arg Gly Pro Gln Ala Gln Tyr Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 309 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 309 Arg Pro His Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 310 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 310 Arg Gly Pro Gln His His His Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 311 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 311 Arg Gly Pro Pro Gln Tyr Ala Pro Pro Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 312 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 312 Arg Gly Pro Gln Cys Tyr Tyr Glu Trp Cys Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 313 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 313 Arg Gly Pro Thr Gln Tyr Ala Glu Gly Gln Ile Asn Glu Gly 1 5 10 <210> SEQ ID NO 314 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 314 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys Gly 1 5 10 15 <210> SEQ ID NO 315 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 315 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys Tyr 1 5 10 15 <210> SEQ ID NO 316 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 316 Arg Gly Pro Gln Gln Tyr Ala Phe Thr Glu Trp Gln Ile Asn Glu Lys 1 5 10 15 <210> SEQ ID NO 317 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 317 Arg Gly Pro Gln Ser Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys Pro 1 5 10 15 Met <210> SEQ ID NO 318 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 318 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys Lys Lys 1 5 10 15 <210> SEQ ID NO 319 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 319 Arg Arg Arg Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu 1 5 10 15 Lys <210> SEQ ID NO 320 <211> LENGTH: 13 <212> TYPE: PRT

<213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 320 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu 1 5 10 <210> SEQ ID NO 321 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 321 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn 1 5 10 <210> SEQ ID NO 322 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 322 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile 1 5 10 <210> SEQ ID NO 323 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 323 Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 324 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 324 Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 325 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 325 Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 326 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 326 Gln Gln Tyr Ala Glu Trp Gln Ile 1 5 <210> SEQ ID NO 327 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 327 Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu 1 5 10 <210> SEQ ID NO 328 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 328 Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn 1 5 10 <210> SEQ ID NO 329 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 329 Arg Gly Pro Gln Gln Tyr Ala 1 5 <210> SEQ ID NO 330 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 330 Glu Trp Gln Ile Asn Glu Lys 1 5 <210> SEQ ID NO 331 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 331 Glu Trp Gln Ile Asn Glu Lys 1 5 <210> SEQ ID NO 332 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 332 Phe Leu Pro Gln His Thr Asp 1 5 <210> SEQ ID NO 333 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 333 Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 334 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 334 Pro Gly Gln Leu Gln Ser Phe Leu Leu Ser Gly Asn 1 5 10 <210> SEQ ID NO 335 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 335 Pro Gly Gln Leu Gln Ser Phe Leu Leu Ser Gly Asn Gln Asn Gln Gln 1 5 10 15 Asn Tyr Leu Ser Gly Phe 20 <210> SEQ ID NO 336 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 336 Pro Gln Gln Tyr Ala Glu Trp Gln 1 5 <210> SEQ ID NO 337 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 337 Gln Leu Gln Ser Phe Leu Leu Ser Gly Asn Gln Asn Gln Gln Asn Tyr 1 5 10 15 Leu Ser Gly Phe Ser Lys 20 <210> SEQ ID NO 338 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 338 Gln Asn Gln Gln Asn Tyr Leu Ser Gly Phe Ser Lys 1 5 10 <210> SEQ ID NO 339

<211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 339 Gln Ser Phe Leu Leu Ser Gly Asn Gln Asn Gln Gln 1 5 10 <210> SEQ ID NO 340 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 340 Gln Ser Phe Leu Leu Ser Gly Asn Gln 1 5 <210> SEQ ID NO 341 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 341 Arg Gly Pro Gln Gln Tyr Ala 1 5 <210> SEQ ID NO 342 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 342 Asp Ala Leu Glu Pro Asp Asn Arg 1 5 <210> SEQ ID NO 343 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 343 Ser Glu Glu Gly Tyr Tyr Gly Glu Gln Gln Gln Gln Pro Gly Met Thr 1 5 10 15 Arg <210> SEQ ID NO 344 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 344 Gly Tyr Tyr Gly Glu Gln Gln Gln Gln Pro Gly Met Thr Arg 1 5 10 <210> SEQ ID NO 345 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 345 Ile Asp Gly Tyr Asp Thr Pro Val Glu Gly Arg 1 5 10 <210> SEQ ID NO 346 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 346 Asn Gly Val Leu Arg Pro Gly Gln Leu 1 5 <210> SEQ ID NO 347 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 347 Arg His Gly Glu Trp Gly Pro Ser Tyr 1 5 <210> SEQ ID NO 348 <211> LENGTH: 4 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 348 Phe Trp Met Ala 1 <210> SEQ ID NO 349 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 349 Thr Val Phe Asp Gly Val Leu Arg Pro Gly Gln Leu 1 5 10 <210> SEQ ID NO 350 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 350 Arg Leu Gln Ser Gln Asn Asp Gln Arg Gly Glu Ile Ile His Val Lys 1 5 10 15 <210> SEQ ID NO 351 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 351 His Gly Pro Val Glu Met Pro Tyr Thr Leu Leu Tyr Pro Ser Ser Lys 1 5 10 15 <210> SEQ ID NO 352 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 352 Leu Asp Ala Leu Glu Pro Asp Asn Arg 1 5 <210> SEQ ID NO 353 <211> LENGTH: 186 <212> TYPE: PRT <213> ORGANISM: Oryza sativa <400> SEQUENCE: 353 Met Ala Ser Lys Val Val Phe Phe Ala Ala Ala Leu Met Ala Ala Met 1 5 10 15 Val Ala Ile Ser Gly Ala Gln Leu Ser Glu Ser Glu Met Arg Phe Arg 20 25 30 Asp Arg Gln Cys Gln Arg Glu Val Gln Asp Ser Pro Leu Asp Ala Cys 35 40 45 Arg Gln Val Leu Asp Arg Gln Leu Thr Gly Arg Glu Arg Phe Gln Pro 50 55 60 Met Phe Arg Arg Pro Gly Ala Leu Gly Leu Arg Met Gln Cys Cys Gln 65 70 75 80 Gln Leu Gln Asp Val Ser Arg Glu Cys Arg Cys Ala Ala Ile Arg Arg 85 90 95 Met Val Arg Ser Tyr Glu Glu Ser Met Pro Met Pro Leu Glu Gln Gly 100 105 110 Trp Ser Ser Ser Ser Ser Glu Tyr Tyr Gly Gly Glu Gly Ser Ser Ser 115 120 125 Glu Gln Gly Tyr Tyr Gly Glu Gly Ser Ser Glu Glu Gly Tyr Tyr Gly 130 135 140 Glu Gln Gln Gln Gln Pro Gly Met Thr Arg Val Arg Leu Thr Arg Ala 145 150 155 160 Arg Gln Tyr Ala Ala Gln Leu Pro Ser Met Cys Arg Val Glu Pro Gln 165 170 175 Gln Cys Ser Ile Phe Ala Ala Gly Gln Tyr 180 185 <210> SEQ ID NO 354 <211> LENGTH: 517 <212> TYPE: PRT <213> ORGANISM: Pisum sativum <400> SEQUENCE: 354 Met Ala Lys Leu Leu Ala Leu Ser Leu Ser Phe Cys Phe Leu Leu Leu 1 5 10 15 Gly Gly Cys Phe Ala Leu Arg Glu Gln Pro Gln Gln Asn Glu Cys Gln 20 25 30 Leu Glu Arg Leu Asp Ala Leu Glu Pro Asp Asn Arg Ile Glu Ser Glu 35 40 45 Gly Gly Leu Ile Glu Thr Trp Asn Pro Asn Asn Lys Gln Phe Arg Cys 50 55 60 Ala Gly Val Ala Leu Ser Arg Ala Thr Leu Gln Arg Asn Ala Leu Arg 65 70 75 80 Arg Pro Tyr Tyr Ser Asn Ala Pro Gln Glu Ile Phe Ile Gln Gln Gly 85 90 95

Asn Gly Tyr Phe Gly Met Val Phe Pro Gly Cys Pro Glu Thr Phe Glu 100 105 110 Glu Pro Gln Glu Ser Glu Gln Gly Glu Gly Arg Arg Tyr Arg Asp Arg 115 120 125 His Gln Lys Val Asn Arg Phe Arg Glu Gly Asp Ile Ile Ala Val Pro 130 135 140 Thr Gly Ile Val Phe Trp Met Tyr Asn Asp Gln Asp Thr Pro Val Ile 145 150 155 160 Ala Val Ser Leu Thr Asp Ile Arg Ser Ser Asn Asn Gln Leu Asp Gln 165 170 175 Met Pro Arg Arg Phe Tyr Leu Ala Gly Asn His Glu Gln Glu Phe Leu 180 185 190 Gln Tyr Gln His Gln Gln Gly Gly Lys Gln Glu Gln Glu Asn Glu Gly 195 200 205 Asn Asn Ile Phe Ser Gly Phe Lys Arg Asp Tyr Leu Glu Asp Ala Phe 210 215 220 Asn Val Asn Arg His Ile Val Asp Arg Leu Gln Gly Arg Asn Glu Asp 225 230 235 240 Glu Glu Lys Gly Ala Ile Val Lys Val Lys Gly Gly Leu Ser Ile Ile 245 250 255 Ser Pro Pro Glu Lys Gln Ala Arg His Gln Arg Gly Ser Arg Gln Glu 260 265 270 Glu Asp Glu Asp Glu Glu Lys Gln Pro Arg His Gln Arg Gly Ser Arg 275 280 285 Gln Glu Glu Glu Glu Asp Glu Asp Glu Glu Arg Gln Pro Arg His Gln 290 295 300 Arg Arg Arg Gly Glu Glu Glu Glu Glu Asp Lys Lys Glu Arg Gly Gly 305 310 315 320 Ser Gln Lys Gly Lys Ser Arg Arg Gln Gly Asp Asn Gly Leu Glu Glu 325 330 335 Thr Val Cys Thr Ala Lys Leu Arg Leu Asn Ile Gly Pro Ser Ser Ser 340 345 350 Pro Asp Ile Tyr Asn Pro Glu Ala Gly Arg Ile Lys Thr Val Thr Ser 355 360 365 Leu Asp Leu Pro Val Leu Arg Trp Leu Lys Leu Ser Ala Glu His Gly 370 375 380 Ser Leu His Lys Asn Ala Met Phe Val Pro His Tyr Asn Leu Asn Ala 385 390 395 400 Asn Ser Ile Ile Tyr Ala Leu Lys Gly Arg Ala Arg Leu Gln Val Val 405 410 415 Asn Cys Asn Gly Asn Thr Val Phe Asp Gly Glu Leu Glu Ala Gly Arg 420 425 430 Ala Leu Thr Val Pro Gln Asn Tyr Ala Val Ala Ala Lys Ser Leu Ser 435 440 445 Asp Arg Phe Ser Tyr Val Ala Phe Lys Thr Asn Asp Arg Ala Gly Ile 450 455 460 Ala Arg Leu Ala Gly Thr Ser Ser Val Ile Asn Asn Leu Pro Leu Asp 465 470 475 480 Val Val Ala Ala Thr Phe Asn Leu Gln Arg Asn Glu Ala Arg Gln Leu 485 490 495 Lys Ser Asn Asn Pro Phe Lys Phe Leu Val Pro Ala Arg Glu Ser Glu 500 505 510 Asn Arg Ala Ser Ala 515 <210> SEQ ID NO 355 <211> LENGTH: 861 <212> TYPE: PRT <213> ORGANISM: Pisum sativum <400> SEQUENCE: 355 Met Phe Ser Gly Val Thr Gly Ile Leu Asn Arg Gly His Lys Ile Lys 1 5 10 15 Gly Thr Val Val Leu Met Arg Lys Asn Val Leu Asp Ile Asn Ser Leu 20 25 30 Thr Thr Val Gly Gly Val Ile Gly Gln Gly Phe Asp Ile Leu Gly Ser 35 40 45 Thr Val Asp Asn Leu Thr Ala Phe Leu Gly Arg Ser Val Ser Leu Gln 50 55 60 Leu Ile Ser Ala Thr Lys Pro Asp Ala Thr Gly Lys Gly Lys Leu Gly 65 70 75 80 Lys Ala Thr Phe Leu Glu Gly Ile Ile Ser Ser Leu Pro Thr Leu Gly 85 90 95 Ala Gly Gln Ser Ala Phe Lys Ile His Phe Glu Trp Asp Asp Asp Met 100 105 110 Gly Ile Pro Gly Ala Phe Tyr Ile Lys Asn Phe Met Gln Thr Glu Phe 115 120 125 Phe Leu Val Ser Leu Thr Leu Asp Asp Ile Pro Asn His Gly Ser Ile 130 135 140 Tyr Phe Val Cys Asn Ser Trp Ile Tyr Asn Ala Lys His His Lys Ile 145 150 155 160 Asp Arg Ile Phe Phe Ala Asn Gln Thr Tyr Leu Pro Ser Glu Thr Pro 165 170 175 Ala Pro Leu Val His Tyr Arg Glu Glu Glu Leu Asn Asn Leu Arg Gly 180 185 190 Asp Gly Thr Gly Glu Arg Lys Glu Trp Glu Arg Ile Tyr Asp Tyr Asp 195 200 205 Val Tyr Asn Asp Leu Gly Asn Pro Asp Ser Gly Glu Asn His Ala Arg 210 215 220 Pro Val Leu Gly Gly Ser Glu Thr Tyr Pro Tyr Pro Arg Arg Gly Arg 225 230 235 240 Thr Gly Arg Lys Pro Thr Arg Lys Asp Pro Asn Ser Glu Ser Arg Ser 245 250 255 Asp Tyr Val Tyr Leu Pro Arg Asp Glu Ala Phe Gly His Leu Lys Ser 260 265 270 Ser Asp Phe Leu Thr Tyr Gly Leu Lys Ala Val Ser Gln Asn Val Val 275 280 285 Pro Ala Leu Glu Ser Val Phe Phe Asp Leu Asn Phe Thr Pro Asn Glu 290 295 300 Phe Asp Ser Phe Asp Glu Val His Gly Leu Tyr Glu Gly Gly Ile Lys 305 310 315 320 Leu Pro Thr Asn Ile Leu Ser Gln Ile Ser Pro Leu Pro Val Leu Lys 325 330 335 Glu Ile Phe Arg Thr Asp Gly Glu Asn Thr Leu Lys Tyr Pro Pro Pro 340 345 350 Lys Val Ile Gln Val Ser Arg Ser Gly Trp Met Thr Asp Glu Glu Phe 355 360 365 Ala Arg Glu Met Leu Ala Gly Val Asn Pro Asn Val Ile Cys Cys Leu 370 375 380 Gln Glu Phe Pro Pro Arg Ser Lys Leu Asp Ser Gln Ile Tyr Gly Asp 385 390 395 400 His Thr Ser Lys Ile Ser Lys Glu His Leu Glu Pro Asn Leu Glu Gly 405 410 415 Leu Thr Val Glu Glu Ala Ile Gln Asn Lys Lys Leu Phe Leu Leu Asp 420 425 430 His His Asp Ser Ile Met Pro Tyr Leu Arg Arg Ile Asn Ser Thr Ser 435 440 445 Thr Lys Ala Tyr Ala Thr Arg Thr Ile Leu Phe Leu Asn Asn Asn Gln 450 455 460 Asn Leu Lys Pro Leu Ala Ile Glu Leu Ser Leu Pro His Pro Gln Gly 465 470 475 480 Asp Glu His Gly Ala Val Ser Tyr Val Tyr Gln Pro Ala Leu Glu Gly 485 490 495 Val Glu Ser Ser Ile Trp Leu Leu Ala Lys Ala Tyr Val Ile Val Asn 500 505 510 Asp Ser Cys Tyr His Gln Leu Val Ser His Trp Leu Asn Thr His Ala 515 520 525 Val Val Glu Pro Phe Val Ile Ala Thr Asn Arg His Leu Ser Cys Leu 530 535 540 His Pro Ile Tyr Lys Leu Leu Tyr Pro His Tyr Arg Asp Thr Met Asn 545 550 555 560 Ile Asn Ser Leu Ala Arg Leu Ser Leu Val Asn Asp Gly Gly Ile Ile 565 570 575 Glu Lys Thr Phe Leu Trp Gly Arg Tyr Ser Met Glu Met Ser Ser Lys 580 585 590 Val Tyr Lys Asn Trp Val Phe Thr Glu Gln Ala Leu Pro Ala Asp Leu 595 600 605 Ile Lys Arg Gly Met Ala Ile Glu Asp Pro Ser Ser Pro Cys Gly Val 610 615 620 Lys Leu Val Val Glu Asp Tyr Pro Tyr Ala Val Asp Gly Leu Glu Ile 625 630 635 640 Trp Ala Ile Ile Lys Thr Trp Val Gln Asp Tyr Val Ser Leu Tyr Tyr 645 650 655 Thr Ser Asp Glu Lys Leu Arg Gln Asp Ser Glu Leu Gln Ala Trp Trp 660 665 670 Lys Glu Leu Val Glu Val Gly His Gly Asp Lys Lys Asn Glu Pro Trp 675 680 685 Trp Pro Lys Met Gln Thr Arg Glu Asp Leu Ile Glu Val Cys Ser Ile 690 695 700 Val Ile Trp Thr Ala Ser Ala Leu His Ala Ala Val Asn Phe Gly Gln 705 710 715 720 Tyr Ser Tyr Gly Gly Leu Ile Leu Asn Arg Pro Thr Leu Ser Arg Arg 725 730 735 Phe Met Pro Glu Lys Gly Ser Ala Glu Phe Glu Glu Leu Val Lys Ser 740 745 750 Pro Gln Lys Ala Tyr Leu Lys Thr Ile Thr Pro Lys Phe Gln Thr Leu 755 760 765 Ile Asp Leu Ser Val Ile Glu Ile Leu Ser Arg His Ala Ser Asp Glu 770 775 780 Leu Tyr Leu Gly Glu Arg Asp Asn Pro Asn Trp Thr Ser Asp Lys Arg 785 790 795 800 Ala Leu Glu Ala Phe Lys Lys Phe Gly Asn Lys Leu Ala Glu Ile Glu 805 810 815 Lys Lys Leu Thr Gln Arg Asn Asn Asp Glu Lys Leu Arg Asn Arg His 820 825 830 Gly Pro Val Glu Met Pro Tyr Thr Leu Leu Tyr Pro Ser Ser Lys Glu 835 840 845 Gly Leu Thr Phe Arg Gly Ile Pro Asn Ser Ile Ser Ile 850 855 860

<210> SEQ ID NO 356 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 356 Lys Asn Pro Gln Leu Gln Asp Leu Asp Ile 1 5 10 <210> SEQ ID NO 357 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 357 Gly Gln Ser Thr Ser Gln Trp Gln Ser Ser Arg 1 5 10 <210> SEQ ID NO 358 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 358 Gln Ser Thr Ser Gln Trp Gln Ser Ser Arg 1 5 10 <210> SEQ ID NO 359 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 359 Gln Ser Thr Ser Gln Trp Gln Ser Ser Arg 1 5 10 <210> SEQ ID NO 360 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 360 Glu Glu Glu Glu Gln Gly Glu Glu Glu Ile Asn Lys 1 5 10 <210> SEQ ID NO 361 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 361 Pro Ser Thr Asn Pro Trp His Ser Pro Arg 1 5 10 <210> SEQ ID NO 362 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 362 Ala Gln Ala Gln Asp Gln Tyr Gln Gln Val Gln Tyr Ser Glu 1 5 10 <210> SEQ ID NO 363 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 363 Ser Glu Ala Gly Val Thr Glu Tyr Phe Asp Glu Lys Asn Glu Leu Phe 1 5 10 15 Gln Cys Thr Gly Thr Phe Val Ile Arg Arg 20 25 <210> SEQ ID NO 364 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 364 Gln Ala Gln Ala Gln Asp Gln Tyr Gln Gln Val Gln Tyr Ser Glu 1 5 10 15 <210> SEQ ID NO 365 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 365 Gly Ser Met Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr 1 5 10 <210> SEQ ID NO 366 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 366 Gly Ser Met Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Tyr 1 5 10 <210> SEQ ID NO 367 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 367 Leu Gly Ala Phe Thr Pro Arg Tyr 1 5 <210> SEQ ID NO 368 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 368 Leu Gly Ala Phe Thr Pro Arg Tyr Gln Gln 1 5 10 <210> SEQ ID NO 369 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 369 Ala Leu Gly Val Asn Ala Leu Val Ala Lys Arg Leu Gln Gly Gln Asn 1 5 10 15 <210> SEQ ID NO 370 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 370 Leu Gly Ala Phe Thr Pro Arg Tyr Gln 1 5 <210> SEQ ID NO 371 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 371 Gly Ser Met Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr 1 5 10 <210> SEQ ID NO 372 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 372 Gly Ser Met Gly Leu Thr Phe Pro Gly Cys Pro Ala Thr Tyr 1 5 10 <210> SEQ ID NO 373 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 373 Ser Asn Asn Pro Phe Lys Phe Leu Val Pro Ala Arg Gln Ser 1 5 10 <210> SEQ ID NO 374 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 374 Cys Ala Gly Val Phe Val Ile Arg Arg 1 5

<210> SEQ ID NO 375 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 375 Gly Ser Pro Leu Gln Ser Pro Arg Gly Phe 1 5 10 <210> SEQ ID NO 376 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 376 Arg Ser Ser Trp Gln Gln Gln Ser Tyr 1 5 <210> SEQ ID NO 377 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 377 Ser Phe Gly Gly Ser Pro Leu Gln Ser Pro Arg 1 5 10 <210> SEQ ID NO 378 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 378 Tyr Leu Pro Thr Lys Gln Leu Gln Pro Thr Trp 1 5 10 <210> SEQ ID NO 379 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 379 Gly Lys Pro Arg Ser Ser Trp Gln Gln Gln 1 5 10 <210> SEQ ID NO 380 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 380 Phe Gly Gly Ser Pro Leu Gln Ser Pro Arg Gly 1 5 10 <210> SEQ ID NO 381 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 381 Leu Asn Leu Leu Gly Phe Gly Ile Asn Ala Glu Asn Asn Glu 1 5 10 <210> SEQ ID NO 382 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 382 Gly Ala Leu Met Leu Pro His Tyr Asn 1 5 <210> SEQ ID NO 383 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 383 Gly Ala Leu Met Leu Pro His Tyr Asn Ser Arg 1 5 10 <210> SEQ ID NO 384 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 384 Val Phe Asp Gly Val Leu Arg Pro Gly 1 5 <210> SEQ ID NO 385 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 385 Leu Gln Ser Gln Asn Asp 1 5 <210> SEQ ID NO 386 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 386 Leu Gln Ser Gln Asn Asp Gln Arg Gly Glu Ile 1 5 10 <210> SEQ ID NO 387 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 387 Gln Ser Gln Asn Asp Gln Arg Gly Glu Ile Ile His Val Lys 1 5 10 <210> SEQ ID NO 388 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 388 Arg Gly Glu Ile Ile His Val Lys 1 5 <210> SEQ ID NO 389 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 389 Arg Leu Gln Ser Gln Asn Asp Gln 1 5 <210> SEQ ID NO 390 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 390 Arg Leu Gln Ser Gln Asn Asp Gln Arg Gly 1 5 10 <210> SEQ ID NO 391 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 391 Arg Leu Gln Ser Gln Asn Asp Gln Arg Gly Glu Ile Ile His 1 5 10 <210> SEQ ID NO 392 <211> LENGTH: 4 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 392 Met Pro Met Pro 1 <210> SEQ ID NO 393 <211> LENGTH: 4 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 393 Pro Met Pro Leu 1 <210> SEQ ID NO 394 <211> LENGTH: 6 <212> TYPE: PRT

<213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 394 Leu Glu Pro Asp Asn Arg 1 5 <210> SEQ ID NO 395 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 395 Gly Ile Ala Arg Leu Ala Gly Thr Ser Ser Val Ile Asn 1 5 10 <210> SEQ ID NO 396 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 396 Arg Ser Gln Asn Ile Phe 1 5 <210> SEQ ID NO 397 <211> LENGTH: 4 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 397 Pro Asn Ser Met 1 <210> SEQ ID NO 398 <211> LENGTH: 4 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 398 Gly His Pro Met 1 <210> SEQ ID NO 399 <211> LENGTH: 4 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 399 His Pro Met Ser 1 <210> SEQ ID NO 400 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 400 Phe Leu Pro Gln His Thr Asp 1 5 <210> SEQ ID NO 401 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 401 Glu Trp Gln Ile Asn Glu Lys 1 5 <210> SEQ ID NO 402 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 402 Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu Lys 1 5 10 <210> SEQ ID NO 403 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 403 Pro Gln Gln Tyr Ala Glu Trp Gln 1 5 <210> SEQ ID NO 404 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 404 Arg Gly Pro Gln Gln Tyr Ala 1 5 <210> SEQ ID NO 405 <211> LENGTH: 4 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 405 His Asn Pro Arg 1 <210> SEQ ID NO 406 <400> SEQUENCE: 406 000 <210> SEQ ID NO 407 <400> SEQUENCE: 407 000 <210> SEQ ID NO 408 <211> LENGTH: 4 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 408 His Pro Ser Phe 1 <210> SEQ ID NO 409 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 409 Pro Gly Gln Leu Gln Ser Phe Leu Leu Ser Gly Asn Gln Asn Gln Gln 1 5 10 15 Asn Tyr Leu Ser Gly Phe 20 <210> SEQ ID NO 410 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 410 Gln Leu Gln Ser Phe Leu Leu Ser Gly Asn Gln Asn Gln Gln Asn Tyr 1 5 10 15 Leu Ser Gly Phe Ser Lys 20 <210> SEQ ID NO 411 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 411 Gln Ser Phe Leu Leu Ser Gly Asn Gln Asn Gln Gln 1 5 10 <210> SEQ ID NO 412 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 412 Pro Gly Gln Leu Gln Ser Phe Leu Leu Ser Gly Asn 1 5 10 <210> SEQ ID NO 413 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 413 Gln Ser Phe Leu Leu Ser Gly Asn Gln 1 5

<210> SEQ ID NO 414 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 414 Gln Asn Gln Gln Asn Tyr Leu Ser Gly Phe Ser Lys 1 5 10 <210> SEQ ID NO 415 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 415 Tyr Leu Arg Gly Phe Ser 1 5 <210> SEQ ID NO 416 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 416 Pro Val Glu Met Pro Thr Leu Leu Tyr Pro Ser 1 5 10 <210> SEQ ID NO 417 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 417 Arg Gly Pro Gln Gln Tyr Ala Glu Trp Gln Ile Asn Glu 1 5 10 <210> SEQ ID NO 418 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 418 Thr Val Phe Asp Gly Val Leu Arg Pro Gly Gln Leu 1 5 10 <210> SEQ ID NO 419 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 419 Leu Asp Ala Leu Glu Pro Asp Asn Arg 1 5 <210> SEQ ID NO 420 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 420 Arg Leu Gln Ser Gln Asn Asp Gln Arg Gly Glu Ile Ile His Val Lys 1 5 10 15 <210> SEQ ID NO 421 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 421 Val Leu Asp Leu Ala Ile Pro Val Asn Arg Pro Gly Gln Leu 1 5 10 <210> SEQ ID NO 422 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 422 His Gly Pro Val Glu Met Pro Tyr Thr Leu Leu Tyr Pro Ser Ser Lys 1 5 10 15 <210> SEQ ID NO 423 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 423 Gly Tyr Tyr Gly Glu Gln Gln Gln Gln Pro Gly Met Thr Arg 1 5 10 <210> SEQ ID NO 424 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 424 Ser Glu Glu Gly Tyr Tyr Gly Glu Gln Gln Gln Gln Pro Gly Met Thr 1 5 10 15 Arg <210> SEQ ID NO 425 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Synthetic peptide <400> SEQUENCE: 425 Leu Arg Gly Phe Ser Lys 1 5