فقط کاربران ثبت نام شده می توانند مقالات را ترجمه کنند
ورود به سیستم / ثبت نام
A 1H and 15N NMR investigation through two-dimensional and three-dimensional spectroscopy has been performed on the reduced form ([Fe4S4]2+) of the recombinant high-potential iron-sulfur protein (HiPIP) I from Ectothiorhodospira halophila expressed in Escherichia coli. [Fe4S4]2+ clusters in proteins
فقط کاربران ثبت نام شده می توانند مقالات را ترجمه کنند
ورود به سیستم / ثبت نام
The reduced high-potential iron sulfur protein I from Ectothiorhodospira halophila which contains the [4Fe-4S]2+ polymetallic center has been fully labeled with 15N and 13C. The protein is paramagnetic, the nuclear relaxation times of nuclei close to the paramagnetic ion are drastically shortened
فقط کاربران ثبت نام شده می توانند مقالات را ترجمه کنند
ورود به سیستم / ثبت نام
The photoactive yellow protein (PYP) is a bacterial photoreceptor which is the structural prototype for the PAS domain superfamily of regulators and receptors. PYP is known to have a unique p-hydroxycinnamic acid chromophore, covalently attached to a cysteine. To date, it has not been shown how
فقط کاربران ثبت نام شده می توانند مقالات را ترجمه کنند
ورود به سیستم / ثبت نام
Acid/base titrations of wild-type PYP and mutants, either in buffer or in the presence of chaotropes such as thiocyanate, establish the presence of four spectral forms including the following: a neutral form (446-476 nm), an acidic form (350-355 nm), an alkaline form (430-440 nm), and an
فقط کاربران ثبت نام شده می توانند مقالات را ترجمه کنند
ورود به سیستم / ثبت نام
The complete amino acid sequence of the 125-residue photoactive yellow protein (PYP) from Ectothiorhodospira halophila has been determined to be MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKEVIGKNFFKDVAP+ ++ CTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV. This is the first
کاملترین پایگاه داده گیاهان دارویی با پشتیبانی علمی
به 55 زبان کار می کند
درمان های گیاهی با پشتوانه علم
شناسایی گیاهان توسط تصویر
نقشه GPS تعاملی - گیاهان را در مکان نشان دهید (به زودی)
انتشارات علمی مربوط به جستجوی خود را بخوانید
گیاهان دارویی را با توجه به اثرات آنها جستجو کنید
علایق خود را سازماندهی کنید و با تحقیقات اخبار ، آزمایشات بالینی و حق ثبت اختراع در جریان باشید
علامت یا بیماری را تایپ کنید و در مورد گیاهانی که ممکن است به شما کمک کنند ، بخوانید ، یک گیاه تایپ کنید و بیماری ها و علائمی را که در برابر آن استفاده می شود ، ببینید. * کلیه اطلاعات براساس تحقیقات علمی منتشر شده است