halophila ovalis/cysteine

Koblingen er lagret på utklippstavlen

ArtiklerKliniske studierPatenter

Velg sorteringstype

5 resultater

Sequence-specific assignment of the 1H and 15N nuclear magnetic resonance spectra of the reduced recombinant high-potential iron-sulfur protein I from Ectothiorhodospira halophila.

Bare registrerte brukere kan oversette artikler

Logg inn Registrer deg

A 1H and 15N NMR investigation through two-dimensional and three-dimensional spectroscopy has been performed on the reduced form ([Fe4S4]2+) of the recombinant high-potential iron-sulfur protein (HiPIP) I from Ectothiorhodospira halophila expressed in Escherichia coli. [Fe4S4]2+ clusters in proteins

The solution structure refinement of the paramagnetic reduced high-potential iron-sulfur protein I from Ectothiorhodospira halophila by using stable isotope labeling and nuclear relaxation.

Bare registrerte brukere kan oversette artikler

Logg inn Registrer deg

The reduced high-potential iron sulfur protein I from Ectothiorhodospira halophila which contains the [4Fe-4S]2+ polymetallic center has been fully labeled with 15N and 13C. The protein is paramagnetic, the nuclear relaxation times of nuclei close to the paramagnetic ion are drastically shortened

Heterologous production of Halorhodospira halophila holo-photoactive yellow protein through tandem expression of the postulated biosynthetic genes.

Bare registrerte brukere kan oversette artikler

Logg inn Registrer deg

The photoactive yellow protein (PYP) is a bacterial photoreceptor which is the structural prototype for the PAS domain superfamily of regulators and receptors. PYP is known to have a unique p-hydroxycinnamic acid chromophore, covalently attached to a cysteine. To date, it has not been shown how

Site-specific mutations provide new insights into the origin of pH effects and alternative spectral forms in the photoactive yellow protein from Halorhodospira halophila.

Bare registrerte brukere kan oversette artikler

Logg inn Registrer deg

Acid/base titrations of wild-type PYP and mutants, either in buffer or in the presence of chaotropes such as thiocyanate, establish the presence of four spectral forms including the following: a neutral form (446-476 nm), an acidic form (350-355 nm), an alkaline form (430-440 nm), and an

Primary structure of a photoactive yellow protein from the phototrophic bacterium Ectothiorhodospira halophila, with evidence for the mass and the binding site of the chromophore.

Bare registrerte brukere kan oversette artikler

Logg inn Registrer deg

The complete amino acid sequence of the 125-residue photoactive yellow protein (PYP) from Ectothiorhodospira halophila has been determined to be MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKEVIGKNFFKDVAP+ ++ CTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV. This is the first

Bli med på
facebooksiden vår

Herbal & Natural Medicine

Den mest komplette databasen med medisinske urter støttet av vitenskap

Fungerer på 55 språk
Urtekurer støttet av vitenskap
Urtegjenkjenning etter bilde
Interaktivt GPS-kart - merk urter på stedet (kommer snart)
Les vitenskapelige publikasjoner relatert til søket ditt
Søk medisinske urter etter deres effekter
Organiser dine interesser og hold deg oppdatert med nyheter, kliniske studier og patenter

Skriv inn et symptom eller en sykdom og les om urter som kan hjelpe, skriv en urt og se sykdommer og symptomer den brukes mot.
* All informasjon er basert på publisert vitenskapelig forskning