anemone hortensis/seizures

Linkul este salvat în clipboard

ArticoleStudii cliniceBrevete

Alegeți tipul de sortare

7 rezultate

The crude extract from the sea anemone, Bunodosoma caissarum elicits convulsions in mice: possible involvement of the glutamatergic system.

Numai utilizatorii înregistrați pot traduce articole

The crude extract from the sea anemone, Bunodosoma caissarum caused dose-dependent convulsions by i.c.v. route in mice. The involvement of the glutamatergic system in the convulsions was investigated. MK-801 and ketamine, non-competitive NMDA receptor antagonists, prolonged the latencies for

Behavioral and electroencephalographic analysis of seizures induced by intrahippocampal injection of granulitoxin, a neurotoxic peptide from the sea anemone Bunodosoma granulifera.

Numai utilizatorii înregistrați pot traduce articole

In this study, the behavioral and electroencephalographic (EEG) analysis of seizures induced by the intrahippocampal injection in rats of granulitoxin, a neurotoxic peptide from the sea anemone Bunodosoma granulifera, was determined. The first alterations occurred during microinjection of

Partial sequence and toxic effects of granulitoxin, a neurotoxic peptide from the sea anemone Bundosoma granulifera.

Numai utilizatorii înregistrați pot traduce articole

A neurotoxic peptide, granulitoxin (GRX), was isolated from the sea anemone Bunodosoma granulifera. The N-terminal amino acid sequence of GRX is AKTGILDSDGPTVAGNSLSGT and its molecular mass is 4958 Da by electrospray mass spectrometry. This sequence presents a partial degree of homology with other

Iodine labelling of sea anemone toxin II, and binding to normal and denervated diaphragm.

Numai utilizatorii înregistrați pot traduce articole

1. Sea anemone toxin II (ATX II) which keeps the activated sodium channels open, can be labelled at its histidine residues with 125I up to a specific radioactivity of 500 Ci/mmole. Upon intraventricular injection in mice, ATX II causes acute, short-lasting hyperexcitation and convulsions. Its LD50

Isolation and biological characterization of neurotoxic compounds from the sea anemone Lebrunia danae (Duchassaing and Michelotti, 1860).

Numai utilizatorii înregistrați pot traduce articole

This paper describes two neurotoxic proteins obtained from the Caribbean sea anemone Lebrunia danae. To assess the neurotoxic activity of the venom of L. danae, several bioassays were carried out, and to evaluate the effect of the toxin, Median Lethal Doses (LD(50)) were determined in vivo using sea

Biological activity of sea anemone proteins: I. Toxicity and histopathology.

Numai utilizatorii înregistrați pot traduce articole

The crude as well as partially purified protein fractions from anemone species viz. Heteractis magnifica, Stichodactyla haddoni and Paracodylactis sinensis, collected from the Gulf of Mannar, south east coast of India were found to be toxic at different levels to mice. The mice showed behavioral

Primary structure, behavioral and electroencephalographic effects of an epileptogenic peptide from the sea anemone Bunodosoma cangicum.

Numai utilizatorii înregistrați pot traduce articole

The primary structure of cangitoxin (CGX), a 4958 Da peptide from the sea anemone Bunodosoma cangicum, was determined: GVACRCDSDGPTVRGNSLSGTLWLTGGCPSGWHNCRGSGPFIGYCCKK. CGX contains all the 11 residues that are conserved and the 5 that are conservatively substituted within or between the type 1 and

Alăturați-vă paginii
noastre de facebook

Herbal & Natural Medicine

Cea mai completă bază de date cu plante medicinale susținută de știință

Funcționează în 55 de limbi
Cure pe bază de plante susținute de știință
Recunoașterea ierburilor după imagine
Harta GPS interactivă - etichetați ierburile în locație (în curând)
Citiți publicațiile științifice legate de căutarea dvs.
Căutați plante medicinale după efectele lor
Organizați-vă interesele și rămâneți la curent cu noutățile de cercetare, studiile clinice și brevetele

Tastați un simptom sau o boală și citiți despre plante care ar putea ajuta, tastați o plantă și vedeți boli și simptome împotriva cărora este folosit.
* Toate informațiile se bazează pe cercetări științifice publicate