Serbian
Albanian
Arabic
Armenian
Azerbaijani
Belarusian
Bengali
Bosnian
Catalan
Czech
Danish
Deutsch
Dutch
English
Estonian
Finnish
Français
Greek
Haitian Creole
Hebrew
Hindi
Hungarian
Icelandic
Indonesian
Irish
Italian
Japanese
Korean
Latvian
Lithuanian
Macedonian
Mongolian
Norwegian
Persian
Polish
Portuguese
Romanian
Russian
Serbian
Slovak
Slovenian
Spanish
Swahili
Swedish
Turkish
Ukrainian
Vietnamese
Български
中文(简体)
中文(繁體)

Substituted piperidine compounds

Само регистровани корисници могу преводити чланке
Пријави се / Пријави се
Веза се чува у привремену меморију
Lorna Mitchell
Andrew Bell
Richard Chesworth
Megan Foley
Kevin Kuntz
James Mills
Michael Munchhof

Кључне речи

Информације о патенту

Број патента10577363
Филед09/08/2015
Датум патента03/02/2020

Апстрактан

The present disclosure provides substituted piperidine compounds having Formula (I), and the pharmaceutically acceptable salts and solvates thereof, wherein R.sup.1, B, X, and Z are defined as set forth in the specification. The present disclosure is also directed to the use of compounds of Formula I to treat a disorder responsive to the blockade of SMYD proteins such as SMYD3 or SMYD2. Compounds of the present disclosure are especially useful for treating cancer. ##STR00001##

Захтеви

What is claimed is:

1. A compound having Formula I: ##STR01242## or a pharmaceutically acceptable salt or hydrate thereof, wherein: B is: ##STR01243## X is selected from the group consisting of --S(.dbd.O).sub.2--, S(.dbd.O).sub.2N(R.sup.7)--, --S(.dbd.O).sub.2C(R.sup.8)(H)--, --C(.dbd.O)--, --C(.dbd.O)N(R.sup.7)--, --C(.dbd.O)O--, --C(.dbd.O)C(R.sup.8)(H)--, and --S(.dbd.O).sub.2N(R.sup.7)C(.dbd.O)N(R.sup.11)--; or X is absent; wherein the sulfur atom of --S(.dbd.O).sub.2N(R.sup.7)--, --S(O).sub.2C(R.sup.8)(H)--, or --S(.dbd.O).sub.2N(R.sup.7)C(.dbd.O)N(R.sup.11)-- is attached to the nitrogen atom of B, the carbon atom of --C(.dbd.O)N(R.sup.7)-- or --C(.dbd.O)O-- is attached to the nitrogen atom of B, and the carbonyl carbon atom of --C(.dbd.O)C(R.sup.8)(H)-- is attached the nitrogen atom of B; Z is selected from the group consisting of hydrogen, optionally substituted C.sub.1-6 alkyl, fluoroalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl, [(cycloalkyl)alkylamino]alkyl, [(heterocyclo)alkylamino]alkyl, alkoxyalkyl, optionally substituted C.sub.6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C.sub.3-12 cycloalkyl, aralkyl, and heteroaralkyl; R.sup.1 is cyclopropyl; R.sup.2a, R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, C.sub.1-6 alkyl, C.sub.3-12 cycloalkyl, haloalkyl, hydroxyalkyl, optionally substituted C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl; or R.sup.2a and R.sup.2b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.3a, R.sup.3b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or R.sup.3a and R.sup.3b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.2b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or R.sup.4a and R.sup.4b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.2b, R.sup.3a, R.sup.3b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or R.sup.5a and R.sup.5b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4a, and R.sup.4b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or R.sup.2a and R.sup.5a taken together form a C.sub.1-4 bridge; and R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4a, R.sup.4b, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or R.sup.3a and R.sup.4a taken together form a C.sub.1-4 bridge; and R.sup.2a, R.sup.2b, R.sup.3b, R.sup.4a, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or R.sup.2a and R.sup.4a taken together form a C.sub.1-4 bridge; and R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or R.sup.3a and R.sup.5a taken form a C.sub.1-4 bridge; and R.sup.2a, R.sup.2b, R.sup.3b, R.sup.4a, R.sup.4b, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; R.sup.6 is selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.7 is selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.8 is selected from the group consisting of hydrogen, C.sub.1-4 alkyl, amino, alkylamino, dialkylamino, cycloalkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, hydroxyalkyl, and --N(R.sup.9)C(.dbd.O)R.sup.10; R.sup.9 is selected from the group consisting of hydrogen and C.sub.1-4 alkyl; R.sup.10 is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl; and R.sup.11 is selected from the group consisting of hydrogen and C.sub.1-4 alkyl; with the proviso that said compound having Formula I is not: 5-cyclopropyl-N-(piperidin-4-yl)isoxazole-3-carboxamide; N-(8-azabicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide; N-(1-(2-amino-2-oxoethyl)piperidin-4-yl)-5-cyclopropylisoxazole-3-carboxa- mide; 5-cyclopropyl-N-(1-(methylsulfonyl)piperidin-4-yl)isoxazole-3-carbox- amide; N-(1-benzylpiperidin-4-yl)-5-cyclopropylisoxazole-3-carboxamide; 5-cyclopropyl-N-(1-isobutyrylpiperidin-4-yl)isoxazole-3-carboxamide; N-(1-benzoylpiperidin-4-yl)-5-cyclopropylisoxazole-3-carboxamide; ethyl 4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate; 5-cyclopropyl-N-(1-(furan-3-carbonyl)piperidin-4-yl)isoxazole-3-carboxami- de; 5-cyclopropyl-N-(1-((4-methoxyphenyl)sulfonyl)piperidin-4-yl)isoxazole- -3-carboxamide; 5-cyclopropyl-N-(1-tosylpiperidin-4-yl)isoxazole-3-carboxamide; 5-cyclopropyl-N-(1-(2,6-dimethylpyrimidin-4-yl)piperidin-4-yl)isoxazole-3- -carboxamide; N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-5-cyclopropylisoxazole-- 3-carboxamide; or 5-cyclopropyl-N-(1-(4-isopropyl-5-(pyridin-4-yl)pyrimidin-2-yl)piperidin-- 4-yl)isoxazole-3-carboxamide; or.

2. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein B is: ##STR01244##

3. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein B is: ##STR01245## and R.sup.2a s selected from the group consisting of halo, C.sub.1-6 alkyl, C.sub.3-12 cycloalkyl, haloalkyl, hydroxyalkyl, optionally substituted C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl.

4. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein B is: ##STR01246## and R.sup.3a is selected from the group consisting of halo, C.sub.1-6 alkyl, C.sub.3-12 cycloalkyl, haloalkyl, hydroxyalkyl, optionally substituted C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl.

5. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein B is: ##STR01247## and R.sup.2a and R.sup.2b are each independently selected from the group consisting of halo and C.sub.1-6 alkyl; or R.sup.2a and R.sup.2b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl.

6. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein B is: ##STR01248## and R.sup.3a and R.sup.3b are each independently selected from the group consisting of halo and C.sub.1-6 alkyl; or R.sup.3a and R.sup.3b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl.

7. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein B is: ##STR01249## and R.sup.3a and R.sup.5a are each independently C.sub.1-6 alkyl; or R.sup.3a and R.sup.5a taken together form a C.sub.1-4 bridge.

8. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein B is: ##STR01250## and R.sup.2a and R.sup.3a are each independently C.sub.1-6 alkyl.

9. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein B is: ##STR01251## and R.sup.3a and R.sup.4a are each independently C.sub.1-6 alkyl; or R.sup.3a and R.sup.4a taken together form a C.sub.1-4 bridge.

10. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein B is: ##STR01252## and R.sup.2a and R.sup.5a are each independently selected from the group consisting of C.sub.1-6 alkyl and alkoxycarbonyl; or R.sup.2a and R.sup.5a taken together form a C.sub.1-6 bridge.

11. The compound of claim 1 having Formula III: ##STR01253## or a pharmaceutically acceptable salt or hydrate thereof.

12. The compound of claim 1 having Formula IV: ##STR01254## or a pharmaceutically acceptable salt or hydrate thereof.

13. The compound of claim 1 having Formula V: ##STR01255## or a pharmaceutically acceptable salt or hydrate thereof.

14. The compound of claim 1 having Formula VI: ##STR01256## or a pharmaceutically acceptable salt or hydrate thereof.

15. The compound of claim 1 having Formula VII: ##STR01257## or a pharmaceutically acceptable salt or hydrate thereof.

16. The compound of claim 1 having Formula VIII: ##STR01258## or a pharmaceutically acceptable salt or hydrate thereof.

17. The compound of claim 1 having Formula IX: ##STR01259## or a pharmaceutically acceptable salt or hydrate thereof.

18. The compound of claim 1 having Formula X: ##STR01260## or a pharmaceutically acceptable salt or hydrate thereof.

19. A compound selected from the group consisting of: ##STR01261## ##STR01262## ##STR01263## ##STR01264## ##STR01265## ##STR01266## ##STR01267## ##STR01268## ##STR01269## ##STR01270## ##STR01271## ##STR01272## ##STR01273## ##STR01274## ##STR01275## ##STR01276## ##STR01277## ##STR01278## ##STR01279## ##STR01280## ##STR01281## ##STR01282## ##STR01283## ##STR01284## ##STR01285## ##STR01286## ##STR01287## ##STR01288## ##STR01289## ##STR01290## ##STR01291## ##STR01292## ##STR01293## ##STR01294## ##STR01295## ##STR01296## ##STR01297## ##STR01298## ##STR01299## ##STR01300## ##STR01301## ##STR01302## ##STR01303## ##STR01304## ##STR01305## ##STR01306## ##STR01307## ##STR01308## ##STR01309## ##STR01310## ##STR01311## ##STR01312## ##STR01313## ##STR01314## ##STR01315## ##STR01316## ##STR01317## ##STR01318## ##STR01319## ##STR01320## ##STR01321## ##STR01322## ##STR01323## ##STR01324## ##STR01325## ##STR01326## ##STR01327## ##STR01328## ##STR01329## ##STR01330## ##STR01331## ##STR01332## ##STR01333## ##STR01334## ##STR01335## ##STR01336## ##STR01337## ##STR01338## ##STR01339## or a pharmaceutically acceptable salt or hydrate thereof.

Опис

BACKGROUND OF THE INVENTION

Field of the Invention

The present disclosure provides substituted piperidines as SMYD protein inhibitors, such as SMYD3 and SMYD2 inhibitors, and therapeutic methods of treating conditions and diseases wherein inhibition of SMYD proteins such as SMYD3 and SMYD2 provides a benefit.

Background

Epigenetic regulation of gene expression is an important biological determinant of protein production and cellular differentiation and plays a significant pathogenic role in a number of human diseases. Epigenetic regulation involves heritable modification of genetic material without changing its nucleotide sequence. Typically, epigenetic regulation is mediated by selective and reversible modification (e.g., methylation) of DNA and proteins (e.g., histones) that control the conformational transition between transcriptionally active and inactive states of chromatin. These covalent modifications can be controlled by enzymes such as methyltransferases (e.g., SMYD proteins such as SMYD3 and SMYD2), many of which are associated with genetic alterations that can cause human disease, such as proliferative disorders. Thus, there is a need for the development of small molecules that are capable of inhibiting the activity of SMYD proteins such as SMYD3 and SMYD2.

BRIEF SUMMARY OF THE INVENTION

In one aspect, the present disclosure provides substituted piperidine compounds represented by any one of Formulae I-X below, and the pharmaceutically acceptable salts and solvates thereof, collectively referred to herein as "Compounds of the Disclosure."

In another aspect, the present disclosure provides a Compound of the Disclosure and one or more pharmaceutically acceptable carriers.

In another aspect, the present disclosure provides a method of inhibiting SMYD proteins, such as SMYD3 or SMYD2, or both, in a mammal, comprising administering to the mammal an effective amount of at least one Compound of the Disclosure.

In another aspect, the present disclosure provides methods for treating a disease, disorder, or condition, e.g., cancer, responsive to inhibition of SMYD proteins, such as SMYD3 or SMYD2, or both, comprising administering a therapeutically effective amount of a Compound of the Disclosure.

In another aspect, the present disclosure provides the use of Compounds of the Disclosure as inhibitors of SMYD3.

In another aspect, the present disclosure provides the use of Compounds of the Disclosure as inhibitors of SMYD2.

In another aspect, the present disclosure provides the use of Compounds of the Disclosure as inhibitors of SMYD proteins.

In another aspect, the present disclosure provides a pharmaceutical composition for treating a disease, disorder, or condition responsive to inhibition of SMYD proteins, such as SMYD3 or SMYD2, or both, wherein the pharmaceutical composition comprises a therapeutically effective amount of a Compound of the Disclosure in a mixture with one or more pharmaceutically acceptable carriers.

In another aspect, the present disclosure provides Compounds of the Disclosure for use in treating cancer in a mammal, e.g., breast, cervical, colon, kidney, liver, head and neck, skin, pancreatic, ovary, esophageal, lung, and prostate cancer.

In another aspect, the present disclosure provides a Compound of the Disclosure for use in the manufacture of a medicament for treating cancer in a mammal.

In another aspect, the present disclosure provides kit comprising a Compound of the Disclosure.

Additional embodiments and advantages of the disclosure will be set forth, in part, in the description that follows, and will flow from the description, or can be learned by practice of the disclosure. The embodiments and advantages of the disclosure will be realized and attained by means of the elements and combinations particularly pointed out in the appended claims.

It is to be understood that both the foregoing summary and the following detailed description are exemplary and explanatory only, and are not restrictive of the invention as claimed.

DETAILED DESCRIPTION OF THE INVENTION

One aspect of the present disclosure is based on the use of Compounds of the Disclosure as inhibitors of SMYD proteins. In view of this property, the Compounds of the Disclosure are useful for treating diseases, disorders, or conditions, e.g., cancer, responsive to inhibition of SMYD proteins.

One aspect of the present disclosure is based on the use of Compounds of the Disclosure as inhibitors of SMYD3. In view of this property, the Compounds of the Disclosure are useful for treating diseases, disorders, or conditions, e.g., cancer, responsive to inhibition of SMYD3.

One aspect of the present disclosure is based on the use of Compounds of the Disclosure as inhibitors of SMYD2. In view of this property, the Compounds of the Disclosure are useful for treating diseases, disorders, or conditions, e.g., cancer, responsive to inhibition of SMYD2.

In one embodiment, Compounds of the Disclosure are compounds having Formula I:

##STR00002## and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein:

B is:

##STR00003##

X is selected from the group consisting of --S(.dbd.O).sub.2--, --S(.dbd.O).sub.2N(R.sup.7)--, --S(.dbd.O).sub.2C(R.sup.8)(H)--, --C(.dbd.O)--, --C(.dbd.O)N(R.sup.7)--, --C(.dbd.O)O--, --C(.dbd.O)C(R.sup.8)(H)--, and --S(.dbd.O).sub.2N(R.sup.7)C(.dbd.O)N(R.sup.11)--; or X is absent, (i.e., Z forms a bond with the nitrogen atom),

wherein the sulfur atom of --S(.dbd.O).sub.2N(R.sup.7)--, --S(.dbd.O).sub.2C(R.sup.8)(H)--, or --S(.dbd.O).sub.2N(R.sup.7)C(.dbd.O)N(R.sup.11)-- is attached to the nitrogen atom of B, the carbon atom of --C(.dbd.O)N(R.sup.7)-- or --C(.dbd.O)O-- is attached to the nitrogen atom of B, and the carbonyl carbon atom of --C(.dbd.O)C(R.sup.8)(H)-- is attached the nitrogen atom of B;

Z is selected from the group consisting of hydrogen, optionally substituted C.sub.1-6 alkyl, fluoroalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl, [(cycloalkyl)alkylamino]alkyl, [(heterocyclo)alkylamino]alkyl, alkoxyalkyl, optionally substituted C.sub.6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C.sub.3-12 cycloalkyl, aralkyl, and heteroaralkyl;

R.sup.1 is selected from the group consisting of ethyl, n-propyl, isopropyl, isobutyl, and cyclopropyl;

R.sup.2a, R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, C.sub.1-6 alkyl, C.sub.3-12 cycloalkyl, haloalkyl, hydroxyalkyl, optionally substituted C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl; or

R.sup.2a and R.sup.2b taken together with the carbon atom to which they are attached forma C.sub.3-6 cycloalkyl; and R.sup.3a, R.sup.3b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.3a and R.sup.3b taken together with the carbon atom to which they are attached forma C.sub.3-6 cycloalkyl; and R.sup.3a, R.sup.3b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.4a and R.sup.4b taken together with the carbon atom to which they are attached forma C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.2b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.5a and R.sup.5b taken together with the carbon atom to which they are attached forma C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4a, and R.sup.4b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.2a and R.sup.5a taken together form a C.sub.1-4 bridge; and R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4a, R.sup.4b, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.3a and R.sup.4a taken together form a C.sub.1-4 bridge; and R.sup.2a, R.sup.2b, R.sup.3b, R.sup.4a, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.2a and R.sup.4a taken together form a C.sub.1-4 bridge; and R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.3a and R.sup.5a taken form a C.sub.1-4 bridge; and R.sup.2a, R.sup.2b, R.sup.3b, R.sup.4a, R.sup.4b, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl;

R.sup.6 is selected from the group consisting of hydrogen and C.sub.1-4 alkyl;

R.sup.7 is selected from the group consisting of hydrogen and C.sub.1-4 alkyl;

R.sup.8 is selected from the group consisting of hydrogen, C.sub.1-4 alkyl, amino, alkylamino, dialkylamino, cycloalkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, hydroxyalkyl, and --N(R.sup.9)C(.dbd.O)R.sup.10;

R.sup.9 is selected from the group consisting of hydrogen and C.sub.1-4 alkyl;

R.sup.10 is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, and (dialkylamino)alkyl; and

R.sup.11 is selected from the group consisting of hydrogen and C.sub.1-4 alkyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is selected from the group consisting of ethyl and cyclopropyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z is selected from the group consisting of optionally substituted C.sub.1-6 alkyl, fluoroalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl, alkoxyalkyl, optionally substituted C.sub.6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C.sub.3-12 cycloalkyl, aralkyl, and heteroaralkyl, when X is absent.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is:

##STR00004## R.sup.6 is selected from the group consisting of hydrogen and C.sub.1-4 alkyl; and R.sup.1, X, and Z are as defined above in connection with Formula I. In another embodiment, R.sup.6 is selected from the group consisting of hydrogen and methyl. In another embodiment, R.sup.6 is hydrogen.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is:

##STR00005## R.sup.2a is selected from the group consisting of halo, C.sub.1-6 alkyl, C.sub.3-12 cycloalkyl, haloalkyl, hydroxyalkyl, optionally substituted C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl; and R.sup.1, X, and Z are as defined above in connection with Formula I. In another embodiment, B is selected from the group consisting of:

##STR00006## In another embodiment, R.sup.2a is selected from the group consisting of methyl, ethyl, phenyl, --CF.sub.3, --CO.sub.2Et, and --CH.sub.2OH. In another embodiment, R.sup.2a is --CH.sub.2Ph.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is:

##STR00007## R.sup.3a is selected from the group consisting of halo, C.sub.1-6 alkyl, C.sub.3-12 cycloalkyl, haloalkyl, hydroxyalkyl, optionally substituted C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl; and R.sup.1, X, and Z are as defined above in connection with Formula I. In another embodiment, B is selected from the group consisting of:

##STR00008## In another embodiment, R.sup.3a is selected from the group consisting of methyl, ethyl, propyl, isopropyl, tert-butyl, phenyl, and --CH.sub.2Ph. In another embodiment, R.sup.3a is --CH.sub.2Ph.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is:

##STR00009## R.sup.2a and R.sup.2b are each independently selected from the group consisting of halo and C.sub.1-6 alkyl; or R.sup.2a and R.sup.2b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.1, X, and Z are as defined above in connection with Formula I. In another embodiment, B is selected from the group consisting of:

##STR00010## and R.sup.2a and R.sup.2b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl. In another embodiment, B is selected from the group consisting of:

##STR00011## In another embodiment, B is selected from the group consisting of:

##STR00012## and R.sup.2a and R.sup.2b are each independently selected from the group consisting of halo and C.sub.1-4 alkyl. In another embodiment, R.sup.2a and R.sup.2b are selected from the group consisting of fluoro and methyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is:

##STR00013## R.sup.3a and R.sup.3b are each independently selected from the group consisting of halo and C.sub.1-6 alkyl; or R.sup.3a and R.sup.3b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.1, X, and Z are as defined above in connection with Formula I. In another embodiment, B is selected from the group consisting of:

##STR00014## and R.sup.3a and R.sup.3b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl. In another embodiment, B is selected from the group consisting of:

##STR00015## In another embodiment, B is selected from the group consisting of:

##STR00016## and R.sup.3a and R.sup.3b are each independently selected from the group consisting of halo and C.sub.1-4 alkyl. In another embodiment, R.sup.3a and R.sup.3b are selected from the group consisting of fluoro and methyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is:

##STR00017## R.sup.3a and R.sup.5a are each independently C.sub.1-6 alkyl; or R.sup.3a and R.sup.5a taken together form a C.sub.1-4 bridge; and R.sup.1, X, and Z are as defined above in connection with Formula I. In another embodiment, B is selected from the group consisting of:

##STR00018## In another embodiment, R.sup.3a and R.sup.5a are each independently C.sub.1-4 alkyl. In another embodiment, R.sup.3a and R.sup.5a are each methyl or ethyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is:

##STR00019## and R.sup.1, X, and Z are as defined above in connection with Formula I. In another embodiment, B is selected from the group consisting of:

##STR00020##

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is:

##STR00021## R.sup.2a and R.sup.3a are each independently C.sub.1-6 alkyl; and R.sup.1, X, and Z are as defined above in connection with Formula I. In another embodiment, B is:

##STR00022## In another embodiment, R.sup.2a and R.sup.3a are each independently C.sub.1-4 alkyl. In another embodiment, R.sup.2a and R.sup.3a are each methyl or ethyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is:

##STR00023## R.sup.3a and R.sup.4a are each independently C.sub.1-6 alkyl; or R.sup.3a and R.sup.4a taken together form a C.sub.1-4 bridge; and R.sup.1, X, and Z are as defined above in connection with Formula I. In another embodiment, B is:

##STR00024## In another embodiment, R.sup.3a and R.sup.4a are each independently C.sub.1-4 alkyl. In another embodiment, R.sup.3a and R.sup.4a are each methyl or ethyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is selected from the group consisting of:

##STR00025## and R.sup.1, X, and Z are as defined above in connection with Formula I. In another embodiment, B is selected from the group consisting of:

##STR00026## In another embodiment, B is selected from the group consisting of:

##STR00027##

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is:

##STR00028## R.sup.2a and R.sup.5a are each independently selected from the group consisting of C.sub.1-6 alkyl and alkoxycarbonyl; or R.sup.2a and R.sup.5a taken together form a C.sub.1-4 bridge; and R.sup.1, X, and Z are as defined above in connection with Formula I. In another embodiment, B is:

##STR00029## In another embodiment, R.sup.2a and R.sup.5a are each independently selected from the group consisting of C.sub.1-4 alkyl and alkoxycarbonyl. In another embodiment, R.sup.2a and R.sup.5a are each independently selected from the group consisting of methyl and --CO.sub.2Me.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is --S(.dbd.O).sub.2-- and R.sup.1, B, and Z are as defined above in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is --C(.dbd.O)-- and R.sup.1, B, and Z are as defined above in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is absent and R.sup.1, B, and Z are as defined above in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is --S(.dbd.O).sub.2N(H)-- and R.sup.1, B, and Z are as defined above in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is --C(.dbd.O)N(H)-- and R.sup.1, B, and Z are as defined above in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is --C(.dbd.O)O-- and R.sup.1, B, and Z are as defined above in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is --S(.dbd.O).sub.2CH.sub.2-- and R.sup.1, B, and Z are as defined above in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is --C(.dbd.O)CH.sub.2-- and R.sup.1, B, and Z are as defined above in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is selected from the group consisting of:

##STR00030## R.sup.8 is selected from the group consisting of C.sub.1-4 alkyl, amino, alkylamino, dialkylamino, cycloalkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, hydroxyalkyl, and --N(R.sup.9)C(.dbd.O)R.sup.10; and R.sup.1, R.sup.9, R.sup.10, B, and Z are as defined above in connection with Formula I. In another embodiment, R.sup.8 is selected from the group consisting of --NH.sub.2, --CH.sub.2NH.sub.2, and --N(H)C(.dbd.O)R.sup.10.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is selected from the group consisting of:

##STR00031## R.sup.8 is selected from the group consisting of C.sub.1-4 alkyl, amino, alkylamino, dialkylamino, cycloalkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, hydroxyalkyl, and --N(R.sup.9)C(.dbd.O)R.sup.10; and R.sup.1, R.sup.9, R.sup.10, B, and Z are as defined above in connection with Formula I. In another embodiment, R.sup.8 is selected from the group consisting of --NH.sub.2, --CH.sub.2NH.sub.2, and --N(H)C(.dbd.O)R.sup.10.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, (aralkylamino)alkyl, optionally substituted C.sub.6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, and optionally substituted C.sub.3-12 cycloalkyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula II:

##STR00032## and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein

R.sup.2a, R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, C.sub.1-6 alkyl, C.sub.3-12 cycloalkyl, haloalkyl, hydroxyalkyl, optionally substituted C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl; or

R.sup.2a and R.sup.2b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.3b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.3a and R.sup.3b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.2b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.4a and R.sup.4b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.2b, R.sup.3a, R.sup.3b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.5a and R.sup.5b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4a, and R.sup.4b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.2a and R.sup.5a taken together form a C.sub.1-4 bridge; and R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4a, R.sup.4b, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.3a and R.sup.4a taken together form a C.sub.1-4 bridge; and R.sup.2a, R.sup.2b, R.sup.3b, R.sup.4a, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.2a and R.sup.4a taken together form a C.sub.1-4 bridge; and R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.3a and R.sup.5a taken form a C.sub.1-4 bridge; and R.sup.2a, R.sup.2b, R.sup.3b, R.sup.4a, R.sup.4b, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl;

R.sup.6 is selected from the group consisting of hydrogen and C.sub.1-4 alkyl;

with the proviso that a) one or more of R.sup.2a, R.sup.3a, R.sup.4a, and R.sup.5a is independently selected from the group consisting of halo, C.sub.1-6 alkyl, C.sub.3-12 cycloalkyl, haloalkyl, hydroxyalkyl, optionally substituted C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl; or b) R.sup.6 is C.sub.1-4 alkyl; and

R.sup.1, X, and Z are as defined in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula II, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z is selected from the group consisting of optionally substituted C.sub.1-6 alkyl, fluoroalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl, alkoxyalkyl, optionally substituted C.sub.6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C.sub.3-12 cycloalkyl, aralkyl, and heteroaralkyl, when X is absent.

In another embodiment, Compounds of the Disclosure are compounds having Formula II, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein

R.sup.2a, R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, C.sub.1-6 alkyl, C.sub.3-12 cycloalkyl, haloalkyl, hydroxyalkyl, optionally substituted C.sub.6-14 aryl, aralkyl, and alkoxycarbonyl; or

R.sup.2a and R.sup.2b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.3a, R.sup.3b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.3a and R.sup.3b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.2b, R.sup.4a, R.sup.4b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.4a and R.sup.4b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.2b, R.sup.3a, R.sup.3b, R.sup.5a, and R.sup.5b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; or

R.sup.5a and R.sup.5b taken together with the carbon atom to which they are attached form a C.sub.3-6 cycloalkyl; and R.sup.2a, R.sup.2b, R.sup.3a, R.sup.3b, R.sup.4a, and R.sup.4b are each independently selected from the group consisting of hydrogen, halo, and C.sub.1-4 alkyl; and

R.sup.1, R.sup.6, X, and Z are as defined in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula III:

##STR00033## and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z and R.sup.1 are as defined above in connection with Formula I. In another embodiment, Z is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, optionally substituted C.sub.6-14 aryl, and optionally substituted 4- to 14-membered heterocyclo.

In another embodiment, Compounds of the Disclosure are compounds having Formula IV:

##STR00034## and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z and R.sup.1 are as defined above in connection with Formula I. In another embodiment, Z is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, optionally substituted C.sub.6-14 aryl, and optionally substituted 4- to 14-membered heterocyclo.

In another embodiment, Compounds of the Disclosure are compounds having Formula V:

##STR00035## and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z and R.sup.1 are as defined above in connection with Formula I. In another embodiment, Z is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, optionally substituted C.sub.6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, and optionally substituted C.sub.3-12 cycloalkyl. It will be understood by those of ordinary skill in the art that compounds having Formula V can be drawn in various ways, e.g.,

##STR00036##

In another embodiment, Compounds of the Disclosure are compounds having Formula VI:

##STR00037## and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z and R.sup.1 are as defined above in connection with Formula I. In another embodiment, Z is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, optionally substituted C.sub.6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, and optionally substituted C.sub.3-12 cycloalkyl. It will be understood by those of ordinary skill in the art that compounds having Formula VI can be drawn in various ways, e.g.,

##STR00038##

In another embodiment, Compounds of the Disclosure are compounds having Formula VII:

##STR00039## and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z and R.sup.1 are as defined above in connection with Formula I. In another embodiment, Z is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, optionally substituted C.sub.6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, and optionally substituted C.sub.3-12 cycloalkyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula VIII:

##STR00040## and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z and R.sup.1 are as defined above in connection with Formula I. In another embodiment, Z is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, optionally substituted C.sub.6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, and optionally substituted C.sub.3-12 cycloalkyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula IX:

##STR00041## and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z and R.sup.1 are as defined above in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula X:

##STR00042## and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z and R.sup.1 are as defined above in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is ethyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is ethyl and Z is selected from the group consisting of (heterocyclo)alkyl, (amino)alkyl-substituted phenyl, amino-substituted piperidine, alkylamino-substituted piperidine, dialkylamino-substituted piperidine, and amino-substituted cyclohexyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is n-propyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is n-propyl and Z is selected from the group consisting of (heterocyclo)alkyl, (amino)alkyl-substituted phenyl, amino-substituted piperidine, alkylamino-substituted piperidine, dialkylamino-substituted piperidine, and amino-substituted cyclohexyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is isopropyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is isopropyl and Z is selected from the group consisting of (heterocyclo)alkyl, (amino)alkyl-substituted phenyl, amino-substituted piperidine, alkylamino-substituted piperidine, dialkylamino-substituted piperidine, and amino-substituted cyclohexyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is isobutyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is isobutyl and Z is selected from the group consisting of (heterocyclo)alkyl, (amino)alkyl-substituted phenyl, amino-substituted piperidine, alkylamino-substituted piperidine, dialkylamino-substituted piperidine, and amino-substituted cyclohexyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is cyclopropyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is cyclopropyl and Z is selected from the group consisting of (heterocyclo)alkyl, (amino)alkyl-substituted phenyl, amino-substituted piperidine, alkylamino-substituted piperidine, dialkylamino-substituted piperidine, and amino-substituted cyclohexyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z is (heterocyclo)alkyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z is a (heterocyclo)alkyl having the following structure:

##STR00043## wherein R.sup.12 is selected from the group consisting of hydrogen, fluoroalkyl, hydroxyalkyl, aralkyl, alkyl, cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. In another embodiment, R.sup.12 is selected from the group consisting of hydrogen, fluoroalkyl, hydroxyalkyl, aralkyl, alkyl, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z is selected from the group consisting of:

##STR00044##

In another embodiment, Compounds of the Disclosure are compounds having any one of Formulae I-X, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R.sup.1 is cyclopropyl and Z is selected from the group consisting of:

##STR00045##

In another embodiment, Compounds of the Disclosure are compounds of Table 1, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or a different pharmaceutically acceptable salt thereof. The chemical names of the compounds of Table 1 are provided in Table 1A.

In another embodiment, Compounds of the Disclosure are compounds of Table 2, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or a different pharmaceutically acceptable salt thereof. The chemical names of the compounds of Table 2 are provided in Table 2A.

In another embodiment, Compounds of the Disclosure are compounds of Table 3, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or a different pharmaceutically acceptable salt thereof. The chemical names of the compounds of Table 3 are provided in Table 3A.

In another embodiment, Compounds of the Disclosure are compounds of Tables 1 and 2, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or a different pharmaceutically acceptable salt thereof.

In another embodiment, Compounds of the Disclosure are compounds of Tables 1, 2, and 3, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or a different pharmaceutically acceptable salt thereof.

In another embodiment, Compounds of the Disclosure are compounds of Tables 1, 1A, 2, 2A, 3, and 3A, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or a different pharmaceutically acceptable salt thereof.

In another embodiment, Compounds of the Disclosure are selected from the group consisting of: N-((1R,3R,5S)-8-(((1r,4R)-4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]- octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide; N-((2S,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5-- cyclopropylisoxazole-3-carboxamide; N-((2S,4S)-1-((4-(2-aminopropan-2-yl)phenyl)sulfonyl)-2-methylpiperidin-4- -yl)-5-cyclopropylisoxazole-3-carboxamide; N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa- n-3-yl)-5-cyclopropylisoxazole-3-carboxamide; 5-cyclopropyl-N-((1R,3r,5S)-8-(((1-(4,4,4-trifluorobutyl)piperidin-4-yl)m- ethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3-carboxamide; and N-((1R,3r,5S)-8-((4-(2-aminopropan-2-yl)phenyl)sulfonyl)-8-azabicyclo[3.2- .1]octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide,

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof.

In another embodiment, Compounds of the Disclosure are selected from the group consisting of: N-((1R,3R,5S)-8-(((1r,4R)-4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]- octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide; N-((2S,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5-- cyclopropylisoxazole-3-carboxamide; N-((2S,4S)-1-((4-(2-aminopropan-2-yl)phenyl)sulfonyl)-2-methylpiperidin-4- -yl)-5-cyclopropylisoxazole-3-carboxamide; N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octa- n-3-yl)-5-cyclopropylisoxazole-3-carboxamide; and 5-cyclopropyl-N-((1R,3r,5S)-8-(((1-methylpiperidin-4-yl)methyl)sulfonyl)-- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3-carboxamide,

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof.

It should be appreciated that the Compounds of the Disclosure in certain embodiments are the free base, various salts, and hydrate forms, and are not limited to the particular salt listed in Table 1, Table 2, or Table 3.

TABLE-US-00001 TABLE 1 Cpd. Salt No. Structure Form 1 ##STR00046## HCl 2 ##STR00047## HCl 3 ##STR00048## TFA 4 ##STR00049## TFA 5 ##STR00050## TFA 6 ##STR00051## HCl 7 ##STR00052## HCl 8 ##STR00053## TFA 9 ##STR00054## TFA 10 ##STR00055## HCl 11 ##STR00056## HCl 12 ##STR00057## TFA 13 ##STR00058## HCl 14 ##STR00059## HCl 15 ##STR00060## HCl 16 ##STR00061## None 17 ##STR00062## HCl 18 ##STR00063## None 19 ##STR00064## None 20 ##STR00065## None 21 ##STR00066## HCl 24 ##STR00067## HCl 25 ##STR00068## HCl 26 ##STR00069## HCl 27 ##STR00070## None 28 ##STR00071## None 29 ##STR00072## None 30 ##STR00073## None 31 ##STR00074## None 32 ##STR00075## HCl 33 ##STR00076## HCl 34 ##STR00077## HCl 35 ##STR00078## HCl 36 ##STR00079## HCl 37 ##STR00080## HCl 38 ##STR00081## HCl 39 ##STR00082## HCl 40 ##STR00083## HCl 41 ##STR00084## None 42 ##STR00085## HCl 43 ##STR00086## HCl 44 ##STR00087## HCl 45 ##STR00088## HCl 46 ##STR00089## None 47 ##STR00090## HCl 48 ##STR00091## HCl 49 ##STR00092## None 50 ##STR00093## None 51 ##STR00094## None 52 ##STR00095## HCl 53 ##STR00096## HCl 54 ##STR00097## HCl 55 ##STR00098## HCl 56 ##STR00099## HCl 57 ##STR00100## HCl 58 ##STR00101## HCl 59 ##STR00102## HCl 11 60 ##STR00103## HCl 61 ##STR00104## None 62 ##STR00105## None 63 ##STR00106## HCl 64 ##STR00107## None 65 ##STR00108## None 66 ##STR00109## None 67 ##STR00110## None 68 ##STR00111## None 69 ##STR00112## None 70 ##STR00113## None 71 ##STR00114## HCl 72 ##STR00115## HCl 73 ##STR00116## HCl 74 ##STR00117## None 75 ##STR00118## None 76 ##STR00119## HCl 77 ##STR00120## HCl 78 ##STR00121## HCl 79 ##STR00122## HCl 80 ##STR00123## HCl 81 ##STR00124## HCl 82 ##STR00125## HCl 83 ##STR00126## HCl 84 ##STR00127## None 85 ##STR00128## None 86 ##STR00129## None 87 ##STR00130## HCl 88 ##STR00131## HCl 89 ##STR00132## HCl 90 ##STR00133## None 91 ##STR00134## None 92 ##STR00135## HCl 93 ##STR00136## HCl 94 ##STR00137## None 95 ##STR00138## HCl 96 ##STR00139## HCl 97 ##STR00140## HCl 98 ##STR00141## HCl 99 ##STR00142## None 100 ##STR00143## None 101 ##STR00144## None 102 ##STR00145## None 103 ##STR00146## HCl 104 ##STR00147## None 105 ##STR00148## None 106 ##STR00149## HCl 107 ##STR00150## None 108 ##STR00151## TFA 109 ##STR00152## TFA 110 ##STR00153## None 111 ##STR00154## HCl 112 ##STR00155## HCl 113 ##STR00156## HCl 114 ##STR00157## HCl 115 ##STR00158## HCl 116 ##STR00159## HCl 117 ##STR00160## HCl 118 ##STR00161## HCl 119 ##STR00162## TFA 120 ##STR00163## TFA 121 ##STR00164## HCl 122 ##STR00165## None 123 ##STR00166## HCl 124 ##STR00167## None 125 ##STR00168## HCl

126 ##STR00169## HCl 127 ##STR00170## HCl 128 ##STR00171## HCl 129 ##STR00172## HCl 130 ##STR00173## HCl 131 ##STR00174## HCl 132 ##STR00175## HCl 133 ##STR00176## None 134 ##STR00177## None 135 ##STR00178## HCl 136 ##STR00179## HCl 137 ##STR00180## None 138 ##STR00181## HCl 139 ##STR00182## HCl 140 ##STR00183## None 141 ##STR00184## None 142 ##STR00185## HCl 143 ##STR00186## HCl 144 ##STR00187## None 145 ##STR00188## HCl 146 ##STR00189## TFA 147 ##STR00190## TFA 148 ##STR00191## TFA 149 ##STR00192## TFA 150 ##STR00193## None 151 ##STR00194## TFA 152 ##STR00195## TFA 153 ##STR00196## TFA 154 ##STR00197## TFA 155 ##STR00198## TFA 156 ##STR00199## TFA 157 ##STR00200## TFA 158 ##STR00201## TFA 159 ##STR00202## TFA 160 ##STR00203## TFA 161 ##STR00204## TFA 162 ##STR00205## HCl 163 ##STR00206## HCl 164 ##STR00207## HCl 165 ##STR00208## HCl 166 ##STR00209## HCl 167 ##STR00210## HCl 168 ##STR00211## HCl 169 ##STR00212## HCl 170 ##STR00213## HCl 171 ##STR00214## HCl 172 ##STR00215## HCl 173 ##STR00216## HCl 174 ##STR00217## HCl 175 ##STR00218## HCl 176 ##STR00219## HCl 177 ##STR00220## HCl 178 ##STR00221## TFA 179 ##STR00222## TFA 180 ##STR00223## HCl 181 ##STR00224## HCl 182 ##STR00225## TFA 183 ##STR00226## HCl 184 ##STR00227## HCl 185 ##STR00228## None 186 ##STR00229## None 187 ##STR00230## HCl 188 ##STR00231## HCl 189 ##STR00232## HCl 190 ##STR00233## HCl 191 ##STR00234## TFA 192 ##STR00235## TFA 193 ##STR00236## TFA 194 ##STR00237## TFA 195 ##STR00238## TFA 196 ##STR00239## TFA 197 ##STR00240## TFA 198 ##STR00241## TFA 199 ##STR00242## HCl 201 ##STR00243## None 202 ##STR00244## TFA 203 ##STR00245## None 204 ##STR00246## HCl 205 ##STR00247## HCl 206 ##STR00248## HCl 207 ##STR00249## HCl 208 ##STR00250## HCl 209 ##STR00251## HCl 210 ##STR00252## None 211 ##STR00253## HCl 212 ##STR00254## HCl 213 ##STR00255## None 214 ##STR00256## None 215 ##STR00257## None 216 ##STR00258## None 217 ##STR00259## None 218 ##STR00260## TFA 219 ##STR00261## TFA 220 ##STR00262## TFA 221 ##STR00263## TFA 222 ##STR00264## TFA 223 ##STR00265## None 224 ##STR00266## HCl 225 ##STR00267## HCl 226 ##STR00268## HCl 227 ##STR00269## None 228 ##STR00270## HCl 229 ##STR00271## None 230 ##STR00272## None 231 ##STR00273## None 232 ##STR00274## None 233 ##STR00275## None 234 ##STR00276## HCl 235 ##STR00277## HCl 236 ##STR00278## HCl 237 ##STR00279## HCl 238 ##STR00280## None 239 ##STR00281## None 240 ##STR00282## None 241 ##STR00283## None 242 ##STR00284## None 243 ##STR00285## None 244 ##STR00286## None 245 ##STR00287## None 246 ##STR00288## None 247 ##STR00289## None 248 ##STR00290## None 249 ##STR00291## None 250 ##STR00292## None 251 ##STR00293## None

252 ##STR00294## None 253 ##STR00295## None 254 ##STR00296## None 255 ##STR00297## None 256 ##STR00298## None 257 ##STR00299## None 258 ##STR00300## HCl 259 ##STR00301## HCl 260 ##STR00302## None 261 ##STR00303## None 262 ##STR00304## None 263 ##STR00305## None 264 ##STR00306## HCl 265 ##STR00307## HCl 266 ##STR00308## TFA 267 ##STR00309## HCl 268 ##STR00310## HCl 269 ##STR00311## None 270 ##STR00312## None 271 ##STR00313## None 272 ##STR00314## None 273 ##STR00315## HCl 274 ##STR00316## None 275 ##STR00317## None 276 ##STR00318## None 277 ##STR00319## None 278 ##STR00320## None 279 ##STR00321## None 280 ##STR00322## None 281 ##STR00323## HCl 282 ##STR00324## None 283 ##STR00325## None 284 ##STR00326## HCl 285 ##STR00327## None 286 ##STR00328## None 287 ##STR00329## None 288 ##STR00330## None 289 ##STR00331## None 290 ##STR00332## None 291 ##STR00333## None 292 ##STR00334## HCl 293 ##STR00335## TFA 294 ##STR00336## HCl 295 ##STR00337## HCl 296 ##STR00338## None 297 ##STR00339## TFA 298 ##STR00340## TFA 299 ##STR00341## TFA 300 ##STR00342## TFA 301 ##STR00343## TFA 302 ##STR00344## TFA 303 ##STR00345## TFA 304 ##STR00346## TFA 305 ##STR00347## HCl 306 ##STR00348## HCl 307 ##STR00349## HCl 308 ##STR00350## HCl 309 ##STR00351## HCl 310 ##STR00352## HCl 311 ##STR00353## HCl 312 ##STR00354## HCl 313 ##STR00355## HCl 314 ##STR00356## HCl 315 ##STR00357## None 316 ##STR00358## None 317 ##STR00359## HCl 318 ##STR00360## None 319 ##STR00361## HCl 320 ##STR00362## None 321 ##STR00363## None 322 ##STR00364## None 323 ##STR00365## None 324 ##STR00366## None 325 ##STR00367## None 326 ##STR00368## HCl 327 ##STR00369## None 328 ##STR00370## None 329 ##STR00371## HCl 330 ##STR00372## None 331 ##STR00373## TFA 332 ##STR00374## TFA 333 ##STR00375## HCl 334 ##STR00376## HCl 335 ##STR00377## HCl 336 ##STR00378## HCl 337 ##STR00379## TFA 338 ##STR00380## TFA 339 ##STR00381## HCl 340 ##STR00382## None 341 ##STR00383## HCl 342 ##STR00384## HCl 343 ##STR00385## HCl 344 ##STR00386## None 345 ##STR00387## None 346 ##STR00388## None 347 ##STR00389## None 348 ##STR00390## HCl 349 ##STR00391## HCl 350 ##STR00392## None 351 ##STR00393## None 352 ##STR00394## None 353 ##STR00395## None 354 ##STR00396## None 355 ##STR00397## None 356 ##STR00398## TFA 357 ##STR00399## HCl 358 ##STR00400## HCl 359 ##STR00401## HCl 360 ##STR00402## None 361 ##STR00403## None 362 ##STR00404## None 363 ##STR00405## TFA 364 ##STR00406## HCl 365 ##STR00407## HCl 366 ##STR00408## HCl 367 ##STR00409## HCl 368 ##STR00410## HCl 369 ##STR00411## HCl 370 ##STR00412## HCl 371 ##STR00413## HCl 372 ##STR00414## HCl 373 ##STR00415## HCl 374 ##STR00416## None 375 ##STR00417## HCl 376 ##STR00418## HCl 377 ##STR00419## None

378 ##STR00420## None 379 ##STR00421## None 380 ##STR00422## None 381 ##STR00423## None 382 ##STR00424## HCl 383 ##STR00425## None 384 ##STR00426## TFA 385 ##STR00427## None 386 ##STR00428## None 387 ##STR00429## None 388 ##STR00430## None 389 ##STR00431## HCl 390 ##STR00432## HCl 391 ##STR00433## TFA 392 ##STR00434## HCl 393 ##STR00435## HCl 394 ##STR00436## None 395 ##STR00437## None 396 ##STR00438## HCl 397 ##STR00439## None 398 ##STR00440## None 399 ##STR00441## None 400 ##STR00442## HCl 401 ##STR00443## None 402 ##STR00444## None 403 ##STR00445## None 404 ##STR00446## None 405 ##STR00447## HCl 406 ##STR00448## None 407 ##STR00449## None 408 ##STR00450## None 409 ##STR00451## None 410 ##STR00452## None 411 ##STR00453## None 412 ##STR00454## None 413 ##STR00455## None 414 ##STR00456## None 415 ##STR00457## None 416 ##STR00458## None 417 ##STR00459## None 418 ##STR00460## None 419 ##STR00461## None 420 ##STR00462## None 421 ##STR00463## HCl 422 ##STR00464## HCl 423 ##STR00465## HCl 424 ##STR00466## HCl 425 ##STR00467## HCl 426 ##STR00468## None 427 ##STR00469## None 428 ##STR00470## None 429 ##STR00471## None 430 ##STR00472## None 431 ##STR00473## None 432 ##STR00474## None 433 ##STR00475## None 434 ##STR00476## None 435 ##STR00477## None 436 ##STR00478## None 437 ##STR00479## HCl 438 ##STR00480## TFA 439 ##STR00481## TFA 440 ##STR00482## None 441 ##STR00483## None 442 ##STR00484## None 443 ##STR00485## None 444 ##STR00486## None 445 ##STR00487## HCl 446 ##STR00488## None 447 ##STR00489## None 448 ##STR00490## None 449 ##STR00491## None 450 ##STR00492## None 451 ##STR00493## None 452 ##STR00494## None 453 ##STR00495## None 454 ##STR00496## None 455 ##STR00497## None 456 ##STR00498## None 457 ##STR00499## None 458 ##STR00500## None 459 ##STR00501## None 460 ##STR00502## None 461 ##STR00503## HCl 462 ##STR00504## HCl 463 ##STR00505## HCl 464 ##STR00506## None 465 ##STR00507## None 466 ##STR00508## None 467 ##STR00509## None 468 ##STR00510## TFA 469 ##STR00511## None 470 ##STR00512## TFA 471 ##STR00513## TFA 472 ##STR00514## None 473 ##STR00515## None 474 ##STR00516## None 475 ##STR00517## None 476 ##STR00518## None 477 ##STR00519## None 478 ##STR00520## None 479 ##STR00521## HCl 480 ##STR00522## None 481 ##STR00523## None 482 ##STR00524## None 483 ##STR00525## None 484 ##STR00526## None 485 ##STR00527## None 486 ##STR00528## None 487 ##STR00529## None 488 ##STR00530## TFA 489 ##STR00531## None 490 ##STR00532## None 491 ##STR00533## None 492 ##STR00534## None 493 ##STR00535## None 494 ##STR00536## None 495 ##STR00537## None 496 ##STR00538## None 497 ##STR00539## HCl 498 ##STR00540## HCl 499 ##STR00541## None 500 ##STR00542## None 501 ##STR00543## HCl 502 ##STR00544## HCl

503 ##STR00545## HCl 504 ##STR00546## None 505 ##STR00547## None 506 ##STR00548## HCl 507 ##STR00549## HCl 508 ##STR00550## HCl 509 ##STR00551## None 510 ##STR00552## None 511 ##STR00553## None 512 ##STR00554## HCl 513 ##STR00555## None 514 ##STR00556## None 515 ##STR00557## None 516 ##STR00558## None 517 ##STR00559## None 518 ##STR00560## None 519 ##STR00561## None 520 ##STR00562## HCl 521 ##STR00563## None 522 ##STR00564## HCl 523 ##STR00565## HCl 524 ##STR00566## None 525 ##STR00567## None 526 ##STR00568## None 527 ##STR00569## HCl

TABLE-US-00002 TABLE 2 Cpd. Salt No. Structure Form 528 ##STR00570## None 529 ##STR00571## TFA 530 ##STR00572## None 531 ##STR00573## None 532 ##STR00574## TFA 533 ##STR00575## None 534 ##STR00576## None 535 ##STR00577## None 536 ##STR00578## HCl 537 ##STR00579## None 538 ##STR00580## None 539 ##STR00581## None 540 ##STR00582## None 541 ##STR00583## None 542 ##STR00584## None 543 ##STR00585## None 544 ##STR00586## None 545 ##STR00587## TFA 546 ##STR00588## None 547 ##STR00589## None 548 ##STR00590## None 549 ##STR00591## HCl 550 ##STR00592## None 551 ##STR00593## None 552 ##STR00594## TFA 553 ##STR00595## None 554 ##STR00596## None 555 ##STR00597## None 556 ##STR00598## HCl 557 ##STR00599## None 558 ##STR00600## HCl 559 ##STR00601## TFA 560 ##STR00602## HCl 561 ##STR00603## None 562 ##STR00604## None 563 ##STR00605## HCl 564 ##STR00606## TFA 565 ##STR00607## None 566 ##STR00608## None 567 ##STR00609## TFA 568 ##STR00610## None 569 ##STR00611## None 570 ##STR00612## None 571 ##STR00613## HCl 572 ##STR00614## None 573 ##STR00615## None 574 ##STR00616## None 575 ##STR00617## None 576 ##STR00618## None 577 ##STR00619## None 578 ##STR00620## None 579 ##STR00621## None 580 ##STR00622## TFA 581 ##STR00623## HCl 582 ##STR00624## HCl 583 ##STR00625## None 584 ##STR00626## None 585 ##STR00627## None 586 ##STR00628## HCl 587 ##STR00629## None 588 ##STR00630## None 589 ##STR00631## None 590 ##STR00632## None 591 ##STR00633## None 592 ##STR00634## None 593 ##STR00635## None 594 ##STR00636## TFA 595 ##STR00637## None 596 ##STR00638## None 597 ##STR00639## HCl 598 ##STR00640## TFA 599 ##STR00641## None 600 ##STR00642## HCl 601 ##STR00643## TFA 602 ##STR00644## HCl 603 ##STR00645## TFA 604 ##STR00646## HCl 605 ##STR00647## None 606 ##STR00648## None 607 ##STR00649## None 608 ##STR00650## None 609 ##STR00651## None 610 ##STR00652## TFA 611 ##STR00653## None 612 ##STR00654## None 613 ##STR00655## HCl 614 ##STR00656## None 615 ##STR00657## None 616 ##STR00658## HCl 617 ##STR00659## HCl 618 ##STR00660## HCl 619 ##STR00661## HCl 620 ##STR00662## None 621 ##STR00663## HCl 622 ##STR00664## HCl 623 ##STR00665## None 624 ##STR00666## None 625 ##STR00667## None 626 ##STR00668## None 627 ##STR00669## None 628 ##STR00670## TFA 629 ##STR00671## None 630 ##STR00672## None 631 ##STR00673## None 632 ##STR00674## None 633 ##STR00675## None 634 ##STR00676## None 635 ##STR00677## None 636 ##STR00678## HCl 637 ##STR00679## None 638 ##STR00680## HCl 639 ##STR00681## None 640 ##STR00682## None 641 ##STR00683## HCl 642 ##STR00684## None 643 ##STR00685## None 644 ##STR00686## None 645 ##STR00687## None 646 ##STR00688## TFA 647 ##STR00689## None 648 ##STR00690## None 649 ##STR00691## None 650 ##STR00692## TFA

651 ##STR00693## None 652 ##STR00694## HCl 653 ##STR00695## HCl 654 ##STR00696## None 655 ##STR00697## HCl 656 ##STR00698## HCl 657 ##STR00699## None 658 ##STR00700## None 659 ##STR00701## None 660 ##STR00702## HCl 661 ##STR00703## None 662 ##STR00704## None 663 ##STR00705## None 664 ##STR00706## None 665 ##STR00707## HCl 666 ##STR00708## None 667 ##STR00709## HCl 668 ##STR00710## HCl 669 ##STR00711## None 670 ##STR00712## HCl 671 ##STR00713## None 672 ##STR00714## None 673 ##STR00715## HCl 674 ##STR00716## HCl 675 ##STR00717## None 676 ##STR00718## None 677 ##STR00719## TFA 678 ##STR00720## HCl 679 ##STR00721## None 680 ##STR00722## None 681 ##STR00723## TFA 682 ##STR00724## TFA 683 ##STR00725## HCl 684 ##STR00726## None 685 ##STR00727## None 686 ##STR00728## None 687 ##STR00729## HCl 688 ##STR00730## None 689 ##STR00731## None 690 ##STR00732## None 691 ##STR00733## TFA 692 ##STR00734## HCl 693 ##STR00735## None 694 ##STR00736## None 695 ##STR00737## TFA 696 ##STR00738## HCl 697 ##STR00739## None 698 ##STR00740## HCl 699 ##STR00741## None 700 ##STR00742## None 701 ##STR00743## HCl 702 ##STR00744## HCl 703 ##STR00745## None 704 ##STR00746## TFA 705 ##STR00747## None 706 ##STR00748## None 707 ##STR00749## None 708 ##STR00750## None 709 ##STR00751## None 710 ##STR00752## None 711 ##STR00753## None 712 ##STR00754## None 713 ##STR00755## HCl 714 ##STR00756## HCl 715 ##STR00757## HCl 716 ##STR00758## HCl 717 ##STR00759## None 718 ##STR00760## HCl 719 ##STR00761## HCl 720 ##STR00762## TFA 721 ##STR00763## None 722 ##STR00764## TFA 723 ##STR00765## TFA 724 ##STR00766## None 725 ##STR00767## None 726 ##STR00768## None 727 ##STR00769## None 728 ##STR00770## None 729 ##STR00771## None 730 ##STR00772## HCl 731 ##STR00773## None 732 ##STR00774## None 733 ##STR00775## None 734 ##STR00776## HCl 735 ##STR00777## None 736 ##STR00778## None 737 ##STR00779## None 738 ##STR00780## HCl 739 ##STR00781## None 740 ##STR00782## HCl 741 ##STR00783## None 742 ##STR00784## None 743 ##STR00785## None 744 ##STR00786## None 745 ##STR00787## None 746 ##STR00788## None 747 ##STR00789## None 748 ##STR00790## None 749 ##STR00791## HCl 750 ##STR00792## TFA 751 ##STR00793## None 752 ##STR00794## None 753 ##STR00795## None 754 ##STR00796## None 755 ##STR00797## None 756 ##STR00798## HCl 757 ##STR00799## HCl 758 ##STR00800## HCl 759 ##STR00801## None 760 ##STR00802## TFA 761 ##STR00803## None 762 ##STR00804## None 763 ##STR00805## None 764 ##STR00806## HCl 765 ##STR00807## HCl 766 ##STR00808## None

TABLE-US-00003 TABLE 3 Cpd. Salt No. Structure Form 767 ##STR00809## TFA 768 ##STR00810## TFA 769 ##STR00811## TFA 770 ##STR00812## None 771 ##STR00813## TFA 772 ##STR00814## None 773 ##STR00815## None 774 ##STR00816## None 775 ##STR00817## HCl 776 ##STR00818## None 777 ##STR00819## HCl 778 ##STR00820## TFA 779 ##STR00821## None 780 ##STR00822## None 781 ##STR00823## None 782 ##STR00824## TFA 783 ##STR00825## None 784 ##STR00826## None 785 ##STR00827## None 786 ##STR00828## None 787 ##STR00829## TFA 788 ##STR00830## HCl 789 ##STR00831## None 790 ##STR00832## TFA 791 ##STR00833## None 792 ##STR00834## None 793 ##STR00835## None 794 ##STR00836## None 795 ##STR00837## None 796 ##STR00838## TFA 797 ##STR00839## None 798 ##STR00840## None 799 ##STR00841## None 800 ##STR00842## TFA 801 ##STR00843## HCl 802 ##STR00844## None 803 ##STR00845## None 804 ##STR00846## TFA 805 ##STR00847## None 806 ##STR00848## HCl 807 ##STR00849## TFA 808 ##STR00850## None 809 ##STR00851## TFA 810 ##STR00852## None 811 ##STR00853## HCl 812 ##STR00854## None 813 ##STR00855## TFA 814 ##STR00856## None 815 ##STR00857## None 816 ##STR00858## None 817 ##STR00859## HCl 818 ##STR00860## TFA 819 ##STR00861## None 820 ##STR00862## None 821 ##STR00863## None 822 ##STR00864## None 823 ##STR00865## None 824 ##STR00866## TFA 825 ##STR00867## None 826 ##STR00868## None 827 ##STR00869## None 828 ##STR00870## None 829 ##STR00871## HCl 830 ##STR00872## HCl 831 ##STR00873## HCl 832 ##STR00874## TFA 833 ##STR00875## HCl 834 ##STR00876## None 835 ##STR00877## TFA 836 ##STR00878## None 837 ##STR00879## None 838 ##STR00880## None 839 ##STR00881## None 840 ##STR00882## HCl 841 ##STR00883## None 842 ##STR00884## HCl 843 ##STR00885## HCl 844 ##STR00886## None 845 ##STR00887## None 846 ##STR00888## None 847 ##STR00889## None 848 ##STR00890## None 849 ##STR00891## TFA 850 ##STR00892## None 851 ##STR00893## None 852 ##STR00894## TFA 853 ##STR00895## None 854 ##STR00896## HCl 855 ##STR00897## TFA 856 ##STR00898## HCl 857 ##STR00899## HCl 858 ##STR00900## None 859 ##STR00901## None 860 ##STR00902## None 861 ##STR00903## None 862 ##STR00904## TFA 863 ##STR00905## None 864 ##STR00906## None 865 ##STR00907## HCl 866 ##STR00908## None 867 ##STR00909## None 868 ##STR00910## HCl 869 ##STR00911## None 870 ##STR00912## None 871 ##STR00913## HCl 872 ##STR00914## None 873 ##STR00915## None 874 ##STR00916## HCl 875 ##STR00917## HCl 876 ##STR00918## None 877 ##STR00919## HCl 878 ##STR00920## None 879 ##STR00921## HCl 880 ##STR00922## None 881 ##STR00923## None 882 ##STR00924## HCl 883 ##STR00925## None 884 ##STR00926## HCl 885 ##STR00927## None 886 ##STR00928## HCl 887 ##STR00929## HCl 888 ##STR00930## None 889 ##STR00931## None

890 ##STR00932## None 891 ##STR00933## HCl 892 ##STR00934## None 893 ##STR00935## None 894 ##STR00936## None 895 ##STR00937## TFA 896 ##STR00938## None 897 ##STR00939## HCl 898 ##STR00940## None 899 ##STR00941## None 900 ##STR00942## None 901 ##STR00943## HCl 902 ##STR00944## None 903 ##STR00945## None 904 ##STR00946## None 905 ##STR00947## None 906 ##STR00948## None 907 ##STR00949## HCl 908 ##STR00950## None 910 ##STR00951## HCl 911 ##STR00952## HCl 912 ##STR00953## None 913 ##STR00954## HCl 914 ##STR00955## None 915 ##STR00956## HCl 916 ##STR00957## TFA 917 ##STR00958## None 918 ##STR00959## None 919 ##STR00960## None 920 ##STR00961## None 921 ##STR00962## None 922 ##STR00963## None 923 ##STR00964## None 924 ##STR00965## None 925 ##STR00966## HCl 926 ##STR00967## None 927 ##STR00968## None 928 ##STR00969## HCl 929 ##STR00970## None 930 ##STR00971## None 931 ##STR00972## None 932 ##STR00973## HCl 933 ##STR00974## TFA 934 ##STR00975## None 935 ##STR00976## None 936 ##STR00977## None 937 ##STR00978## None 938 ##STR00979## None 939 ##STR00980## HCl 940 ##STR00981## None 941 ##STR00982## None 942 ##STR00983## HCl 943 ##STR00984## None 944 ##STR00985## None 945 ##STR00986## HCl 946 ##STR00987## None 947 ##STR00988## None 948 ##STR00989## None 949 ##STR00990## HCl 950 ##STR00991## HCl 951 ##STR00992## TFA 952 ##STR00993## None 953 ##STR00994## HCl 954 ##STR00995## HCl 955 ##STR00996## None 956 ##STR00997## None 957 ##STR00998## None 958 ##STR00999## None 959 ##STR01000## HCl 960 ##STR01001## None 961 ##STR01002## None 962 ##STR01003## None 963 ##STR01004## None 964 ##STR01005## None 965 ##STR01006## HCl 966 ##STR01007## None 967 ##STR01008## None 968 ##STR01009## HCl 969 ##STR01010## None 970 ##STR01011## HCl 971 ##STR01012## None 972 ##STR01013## None 973 ##STR01014## None 974 ##STR01015## None 975 ##STR01016## None 976 ##STR01017## None 977 ##STR01018## TFA 978 ##STR01019## None 979 ##STR01020## None 980 ##STR01021## None 981 ##STR01022## None 982 ##STR01023## TFA 983 ##STR01024## None 984 ##STR01025## None 985 ##STR01026## None 986 ##STR01027## None 987 ##STR01028## None 988 ##STR01029## HCl 989 ##STR01030## HCl 990 ##STR01031## None 991 ##STR01032## HCl 992 ##STR01033## None 993 ##STR01034## HCl

TABLE-US-00004 TABLE 1A LCMS SMYD3 SMYD3 M + H Biochem Cell Cpd. or IC.sub.50 IC.sub.50 No. Chemical Name (M + Na) (.mu.M)* (.mu.M)* 1 N-(1-(L-phenylalanyl)piperidin-4-yl)-5- 383.5 2.87638 cyclopropylisoxazole-3-carboxamide 2 N-(1-(D-tryptophyl)piperidin-4-yl)-5- 422.2 15.46877 cyclopropylisoxazole-3-carboxamide 3 N-(1-(L-tyrosyl)piperidin-4-yl)-5- 399.2 0.48617 cyclopropylisoxazole-3-carboxamide 4 5-cyclopropyl-N-(1-(glycyl-L- 479.4 0.94728 tryptophyl)piperidin-4-yl)isoxazole-3- carboxamide 5 (S)-N-(1-(2-amino-3-(4-hydroxy-3- 525.2 0.11601 0.80851 iodophenyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 6 N-((2R)-1-(L-tyrosyl)-2-methylpiperidin- 413.15 2.9693 4-yl)-5-cyclopropylisoxazole-3- carboxamide 7 N-((2S)-1-(L-tyrosyl)-2-methylpiperidin- 413.1 1.04499 4-yl)-5-cyclopropylisoxazole-3- carboxamide 8 5-cyclopropyl-N-(1-(Na,1-dimethyl-L- 450.4 1.19566 tryptophyl)piperidin-4-yl)isoxazole-3- carboxamide 9 (S)-N-(1-(2-amino-3-(3-bromo-4- 477.15 0.21411 hydroxyphenyl)propanoyl)piperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 10 (R)-N-(1-(3-amino-2- 397.1 0.31912 1.81743 benzylpropanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 11 (S)-N-(1-(3-amino-2- 397.1 2.41085 benzylpropanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 12 N-(1-(4-benzylpiperidine-4- 438.2 1.59927 carbonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 13 N-(1-((1r,4R)-4-aminocyclohexane-1- 361.1 1.29457 carbonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 14 (S)-N-(1-(2-amino-3-(4- 385.1 4.59243 hydroxyphenyl)propyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 15 5-cyclopropyl-N-(1-(piperidine-4- 347.1 8.54547 carbonyl)piperidin-4-yl)isoxazole-3- carboxamide 16 5-cyclopropyl-N-(1-(1-methylpiperidine- 361.1 10.04224 4-carbonyl)piperidin-4-yl)isoxazole-3- carboxamide 17 5-cyclopropyl-N-(1-(2-(piperidin-4- 361.1 1.05672 yl)acetyl)piperidin-4-yl)isoxazole-3- carboxamide 18 5-cyclopropyl-N-(1-(2-(1-methylpiperidin- 375.1 5.07998 4-yl)acetyl)piperidin-4-yl)isoxazole-3- carboxamide 19 (R)-N-(1-(2-benzyl-3- 398.1 30.89904 hydroxypropanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 20 N-(1-((1r,3r)-3-aminocyclobutane-1- 333.15 5.77474 carbonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 21 N-(1-((1s,3s)-3-aminocyclobutane-1- 333.1 5.69337 carbonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 24 N-((3S)-1-((1r,4S)-4-aminocyclohexane-1- 375 1.99675 carbonyl)-3-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 25 N-((3R)-1-((1r,4R)-4-aminocyclohexane- 375 0.29888 1-carbonyl)-3-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 26 (R)-N-(1-(3-amino-2-(4- 413.2 5.2367 hydroxybenzyl)propanoyl)piperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 27 (S)-N-(1-(3-amino-2-(4- 413.2 0.34237 hydroxybenzyl)propanoyl)piperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 28 (R)-N-(1-(3-amino-2-(4-hydroxy-3- 539.05 2.04271 iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 29 (S)-N-(1-(3-amino-2-(4-hydroxy-3- 539.05 0.04225 1.10146 iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 30 (R)-5-cyclopropyl-N-(1-(2-hydroxy-3-(4- 386.15 42.67345 hydroxyphenyl)propyl)piperidin-4- yl)isoxazole-3-carboxamide 31 (R)-5-cyclopropyl-N-(1-(3-hydroxy-2-(4- 540 5.09573 hydroxy-3- iodobenzyl)propanoyl)piperidin-4- yl)isoxazole-3-carboxamide 32 N-(1-((R)-3-((S)-3-aminobutanamido)-2- 624 4.11464 (4-hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 33 N-(1-((S)-3-((S)-3-aminobutanamido)-2- 624 0.47322 (4-hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 34 (R)-N-(1-(3-(3-aminopropanamido)-2-(4- 610.1 1.63668 hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 35 (S)-N-(1-(3-(3-aminopropanamido)-2-(4- 610.1 0.11659 hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 36 (R)-N-(1-(3-(2-aminoacetamido)-2-(4- 596.05 9.41289 hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 37 (S)-N-(1-(3-(2-aminoacetamido)-2-(4- 596.05 0.62263 hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 38 (R)-N-(1-(3-amino-2-(3-hydroxy-4- 427.15 0.518 methylbenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 39 (S)-N-(1-(3-amino-2-(3-hydroxy-4- 427.15 13.98028 methylbenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 40 N-(1-(3-aminopropyl)piperidin-4-yl)-5- 293.05 3.1591 cyclopropylisoxazole-3-carboxamide 41 5-cyclopropyl-N-(1- 328 13.88514 (ethylsulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 42 N-(1-((R)-3-((R)-2-aminopropanamido)-2- 610.1 8.39137 (4-hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 43 N-(1-((S)-3-((R)-2-aminopropanamido)-2- 610.1 1.23321 (4-hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 44 N-(1-((R)-3-((R)-3-aminobutanamido)-2- 624.05 13.80215 (4-hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 45 N-(1-((S)-3-((R)-3-aminobutanamido)-2- 624.05 0.47931 (4-hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 46 N-(1-((3-aminopropyl)sulfonyl)-3- 371.1 0.11881 1.0204 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 47 N-((3S)-1-(D-tyrosyl)-3-methylpiperidin- 413.1 14.88112 4-yl)-5-cyclopropylisoxazole-3- carboxamide 48 N-((3R)-1-(D-tyrosyl)-3-methylpiperidin- 413.1 14.91848 4-yl)-5-cyclopropylisoxazole-3- carboxamide 49 5-cyclopropyl-N-((3S)-1-glycyl-3- 307 37.18839 methylpiperidin-4-yl)isoxazole-3- carboxamide 50 5-cyclopropyl-N-((3R,4R)-1-glycyl-3- 307 9.72067 methylpiperidin-4-yl)isoxazole-3- carboxamide 51 5-cyclopropyl-N-((3R,4S)-1-glycyl-3- 307 12.73254 methylpiperidin-4-yl)isoxazole-3- carboxamide 52 5-cyclopropyl-N-((2S)-1-glycyl-2- 307.1 32.52331 methylpiperidin-4-yl)isoxazole-3- carboxamide 53 5-cyclopropyl-N-((2R,4S)-2-methyl-1-(2- 375.1 0.86212 (piperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 54 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(2- 375.1 2.0772 (piperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 55 5-cyclopropyl-N-((2R,4R)-2-methyl-1-(2- 375.1 0.6809 (piperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 56 5-cyclopropyl-N-((2S,4R)-2-methyl-1-(2- 375.1 0.17163 3.18391 (piperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 57 N-((2R,4R)-1-((1r,4R)-4- 375.15 0.07164 0.94669 aminocyclohexane-1-carbonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 58 N-((2R,4S)-1-((1r,4R)-4- (397.2) 1.40209 aminocyclohexane-1-carbonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 59 N-((2S,4S)-1-((1r,4S)-4- (397.15) 7.96967 aminocyclohexane-1-carbonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 60 N-((2S,4R)-1-((1r,4S)-4- 375.1 1.40665 aminocyclohexane-1-carbonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 61 N-(1-((R)-3-((S)-2-aminopropanamido)-2- 610.1 15.29772 (4-hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 62 N-(1-((S)-3-((S)-2-aminopropanamido)-2- 610.1 1.32539 (4-hydroxy-3- iodobenzyl)propanoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 63 (R)-N-(1-(3-amino-2-(3-chloro-4- 447.15 0.13855 1.44404 hydroxybenzyl)propanoyl)piperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 64 (S)-N-(1-(3-amino-2-(3-chloro-4- 447.1 7.15928 hydroxybenzyl)propanoyl)piperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 65 N-((3R)-1-((2-aminoethyl)sulfonyl)-3- 357.1 0.20506 1.05134 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 66 N-((3S)-1-((2-aminoethyl)sulfonyl)-3- 357.1 0.59032 3.71821 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 67 N-((3S)-1-(L-tyrosyl)-3-methylpiperidin- 413.1 2.32362 4-yl)-5-cyclopropylisoxazole-3- carboxamide 68 N-((3R)-1-(L-tyrosyl)-3-methylpiperidin- 413.1 1.68772 4-yl)-5-cyclopropylisoxazole-3- carboxamide 69 5-cyclopropyl-N-((2S)-2-methyl-1-(3- 375.15 12.43914 (pyrrolidin-1-yl)propanoyl)piperidin-4- yl)isoxazole-3-carboxamide 70 5-cyclopropyl-N-((2R)-2-methyl-1-(3- 375.1 7.72648 (pyrrolidin-1-yl)propanoyl)piperidin-4- yl)isoxazole-3-carboxamide 71 N-((2S)-1-((1s,3R)-3-aminocyclobutane-1- 347.1 2.54308 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 72 N-((2S)-1-((1r,3S)-3-aminocyclobutane-1- 347.1 2.72053 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 73 N-(9-((1r,4r)-4-aminocyclohexane-1- 401.1 5.34634 carbonyl)-9-azabicyclo[3.3.1]nonan-3-yl)- 5-cyclopropylisoxazole-3-carboxamide 74 5-cyclopropyl-N-((2S)-1-(ethylsulfonyl)- (362) 1.41476 2-methylpiperidin-4-yl)isoxazole-3- carboxamide 75 5-cyclopropyl-N-((2R)-1-(ethylsulfonyl)- 342.1 7.30714 2-methylpiperidin-4-yl)isoxazole-3- carboxamide 76 5-cyclopropyl-N-((3S,4S)-3-ethyl-1-(2- 389.3 0.54092 (piperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 77 N-((2R)-1-((2-aminoethyl)sulfonyl)-2- 357.1 0.63328 2.90646 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 78 N-((2S)-1-((2-aminoethyl)sulfonyl)-2- 357.05 0.15511 0.79154 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 79 (R)-N-(1-(2-amino-3-(4- 385.1 20.42345

hydroxyphenyl)propyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 80 N-(1-(3-aminopropanoyl)-3- 321.1 6.81137 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 81 5-cyclopropyl-N-((2R)-1-glycyl-2- 307.1 22.11145 methylpiperidin-4-yl)isoxazole-3- carboxamide 82 N-((2S,4S)-1-(3-aminopropanoyl)-2- 321.1 10.50574 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 83 N-((2S,4R)-1-(3-aminopropanoyl)-2- 321.1 6.59727 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 84 N-((2R)-1-(3-aminopropanoyl)-2- 321.1 6.14386 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 85 N-((2S)-1-((1R,3R)-3-aminocyclopentane- 361.2 2.36831 1-carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 86 N-((2S)-1-((1R,3S)-3-aminocyclopentane- 361.2 2.56375 1-carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 87 N-((2R)-1-((1s,3S)-3-aminocyclobutane-1- 347.1 3.25213 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 88 N-(2-((1r,4r)-4-aminocyclohexane-1- 387 0.15617 2.49959 carbonyl)-2-azabicyclo[2.2.2]octan-5-yl)- 5-cyclopropylisoxazole-3-carboxamide 89 N-(1-((1r,4r)-4-aminocyclohexane-1- 437.1 3.3857 carbonyl)-2-phenylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 90 5-cyclopropyl-N-((2S)-2-methyl-1- 389.15 5.33028 ((1r,4S)-4-(methylamino)cyclohexane-1- carbonyl)piperidin-4-yl)isoxazole-3- carboxamide 91 5-cyclopropyl-N-((2S)-2-methyl-1-(2- 376.15 3.91293 (piperazin-1-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 92 5-cyclopropyl-N-((2R)-2-methyl-1-(2- 376.15 0.77789 (piperazin-1-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 93 N-((3S,4S)-1-(4-aminocyclohexane-1- 389.2 1.61465 carbonyl)-3-ethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 94 N-((2S)-1-((1r,4S)-4-aminocyclohexane-1- 389.1 2.37948 carbonyl)-2-ethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 95 N-((2R)-1-((1R,3R)-3-aminocyclopentane- (383.15) 0.53208 1-carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 96 N-((2R)-1-((1R,3S)-3-aminocyclopentane- 361.1 1.89956 1-carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 97 N-((2R)-1-((1r,3R)-3-aminocyclobutane-1- 347.1 0.77892 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 98 N-(1-((1r,4r)-4-aminocyclohexane-1- 403.1 0.65544 carbonyl)-2-propylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 99 N-(1-((1r,4r)-4-aminocyclohexane-1- 403.1 0.23028 3.05094 carbonyl)-2-isopropylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 100 N-(5-((1r,4r)-4-aminocyclohexane-1- (423.2) 2.20456 carbonyl)-5-azaspiro[3.5]nonan-8-yl)-5- cyclopropylisoxazole-3-carboxamide 101 N-((1R,3S,5S)-8-((1r,4R)-4- (409.2) >10 aminocyclohexane-1-carbonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 102 N-((1R,3R,5S)-8-((1r,4R)-4- 387.1 0.10577 1.70139 aminocyclohexane-1-carbonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 103 N-((2S)-1-(4-amino-3,3- 363.2 1.44518 dimethylbutanoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 104 N-((2R)-1-(4-amino-3,3- 363.2 0.56589 dimethylbutanoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 105 5-cyclopropyl-N-((2S)-1-((1r,4S)-4- 403.1 19.98827 (dimethylamino)cyclohexane-1-carbonyl)- 2-methylpiperidin-4-yl)isoxazole-3- carboxamide 106 N-((2S)-1-((1S,3S)-3-aminocyclohexane- 375.1 3.52143 1-carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 107 5-cyclopropyl-N-((2R)-2-methyl-1- 361.2 2.51548 (piperidine-3-carbonyl)piperidin-4- yl)isoxazole-3-carboxamide 108 N-(1-((1r,4r)-4-aminocyclohexane-1- 451.3 1.42279 carbonyl)-2-benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 109 N-(2-benzyl-1-(2-(piperidin-4- 451.2 0.09677 1.92675 yl)acetyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 110 N-((2R)-1-((1r,4R)-4-aminocyclohexane- 389.1 0.09941 0.89293 1-carbonyl)-2-ethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 111 (S)-N-(1-(3-amino-2-(4-hydroxy-3- 481 2.46875 (trifluoromethyl)benzyl)propanoyl)piperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide 112 (R)-N-(1-(3-amino-2-(4-hydroxy-3- 455.1 1.09349 isopropylbenzyl)propanoyl)piperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 113 N-((2R)-1-(((1r,4R)-4- 361.2 4.58751 aminocyclohexyl)methyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 114 N-(1-((1r,4r)-4-aminocyclohexane-1- 389.2 1.30613 carbonyl)-2,2-dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 115 5-cyclopropyl-N-((2S)-2-methyl-1-(2-(4- 389.2 0.4717 methylpiperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 116 5-cyclopropyl-N-((2R)-2-methyl-1-(2-(4- 389.1 2.9085 methylpiperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 117 N-((2S)-1-((1S,3R)-3-aminocyclohexane- 375.25 5.60335 1-carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 118 N-((2R)-1-((2R,5S)-5-aminotetrahydro- 377.25 0.20786 1.35148 2H-pyran-2-carbonyl)-2-methylpiperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide 119 ethyl 4-(5-cyclopropylisoxazole-3- 433.3 2.99148 carboxamido)-1-(2-(piperidin-4- yl)acetyl)piperidine-3-carboxylate 120 (R)-N-(1-(3-amino-2-(4-hydroxy-3- 481.1 0.08157 (trifluoromethyl)benzyl)propanoyl)piperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide 121 (S)-N-(1-(3-amino-2-(4-hydroxy-3- 455.2 0.00957 0.68 isopropylbenzyl)propanoyl)piperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 122 N-((2R)-1-(4-aminopiperidine-1- 376.1 0.85107 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 123 N-(2-((1r,4r)-4-aminocyclohexane-1- 373.1 1.16837 carbonyl)-2-azabicyclo[2.2.1]heptan-5-yl)- 5-cyclopropylisoxazole-3-carboxamide 124 5-cyclopropyl-N-((2R)-2-methyl-1- 389 0.27407 2.24358 ((1r,4R)-4-(methylamino)cyclohexane-1- carbonyl)piperidin-4-yl)isoxazole-3- carboxamide 125 5-cyclopropyl-N-(9-(2-(piperidin-4- 401.1 7.75656 yl)acetyl)-9-azabicyclo[3.3.1]nonan-3- yl)isoxazole-3-carboxamide 126 5-cyclopropyl-N-((1R,3s,5S)-8-(2- 387.1 9.85627 (piperidin-4-yl)acetyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 127 5-cyclopropyl-N-((1R,3r,5S)-8-(2- 387.1 1.27842 (piperidin-4-yl)acetyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 128 N-((2S)-1-(2-(8-azabicyclo[3.2.1]octan-3- 401.25 0.84351 yl)acetyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 129 N-((2R)-1-(2-(8-azabicyclo[3.2.1]octan-3- 401.1 0.59462 yl)acetyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 130 N-((2S)-1-(6-aminospiro[3.3]heptane-2- 387.1 1.30431 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 131 N-((2S)-1-((2R,5S)-5-aminotetrahydro- 377.1 2.08144 2H-pyran-2-carbonyl)-2-methylpiperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide 132 5-cyclopropyl-N-((2S)-2-methyl-1- 361.2 5.54521 (piperidine-3-carbonyl)piperidin-4- yl)isoxazole-3-carboxamide 133 N-((2S)-1-((R)-5-amino-3- 365.1 6.23726 hydroxypentanoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 134 N-((2R)-1-((R)-5-amino-3- 365.2 1.85646 hydroxypentanoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 135 5-cyclopropyl-N-((2R)-1-(5- 377.1 2.48647 hydroxypiperidine-3-carbonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 136 5-cyclopropyl-N-((2R)-2-methyl-1-(6- 387.1 0.75897 azaspiro[2.5]octane-1-carbonyl)piperidin- 4-yl)isoxazole-3-carboxamide 137 5-cyclopropyl-N-((2R)-1-((1r,4R)-4- 376.25 41.16974 hydroxycyclohexane-1-carbonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 138 N-((2S)-1-(((1r,4S)-4- 361.1 4.30775 aminocyclohexyl)methyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 139 5-cyclopropyl-N-((2R)-1-((1r,4R)-4- 403.1 1.6468 (dimethylamino)cyclohexane-1-carbonyl)- 2-methylpiperidin-4-yl)isoxazole-3- carboxamide 140 5-cyclopropyl-N-((2R)-2-methyl-1-(2-(3- 389.25 0.84236 methylpiperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 141 5-cyclopropyl-N-((2S)-2-methyl-1-(2-(2- 389.35 3.52551 methylpiperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 142 N-((2S)-1-(4-aminobutanoyl)-2- 335.1 3.64524 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 143 N-((2R)-1-((1S,3R)-3-aminocyclohexane- 375.1 1.98991 1-carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 144 5-cyclopropyl-N-((2R)-2-methyl-1-(6- 387.25 0.54601 azaspiro[3.4]octane-2-carbonyl)piperidin- 4-yl)isoxazole-3-carboxamide 145 N-(1-((1R,3R)-3-aminocyclopentane-1- 347.1 5.97994 carbonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 146 N-((3R,4R)-1-((1r,4R)-4- 375.3 2.27591 aminocyclohexane-1-carbonyl)-3- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 147 5-cyclopropyl-N-((3R,4R)-3-methyl-1-(2- 375.1 1.52725 (piperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 148 N-((3R,4S)-1-((1r,4R)-4- 375.3 0.28218 1.81302 aminocyclohexane-1-carbonyl)-3- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 149 5-cyclopropyl-N-((3R,4S)-3-methyl-1-(2- 375.1 0.29052 3.22445 (piperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 150 N-(1-((1r,4r)-4-aminocyclohexane-1- 375.1 0.90972 carbonyl)-4-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 151 ethyl 1-((1r,4r)-4-aminocyclohexane-1- 433.3 3.53948 carbonyl)-4-(5-cyclopropylisoxazole-3- carboxamido)piperidine-3-carboxylate 152 N-(1-((1r,4r)-4-aminocyclohexane-1- 397.1 2.2474 carbonyl)-3,3-difluoropiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 153 5-cyclopropyl-N-(4-methyl-1-(2- 375.3 0.8483 (piperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 154 5-cyclopropyl-N-(3,3-difluoro-1-(2- 397.1 1.55665 (piperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 155 N-(1-((1r,4r)-4-aminocyclohexane-1- 389.3 0.57463 carbonyl)-3,3-dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 156 N-(5-((1r,4r)-4-aminocyclohexane-1- 387.2 0.24493 1.75569 carbonyl)-5-azaspiro[2.5]octan-8-yl)-5- cyclopropylisoxazole-3-carboxamide

157 5-cyclopropyl-N-(3,3-dimethyl-1-(2- 389.3 0.52149 (piperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 158 N-(1-(4-aminobutanoyl)-4- 335.2 7.3363 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 159 ethyl (2S)-1-(4-aminobutanoyl)-4-(5- 393.2 25.18182 cyclopropylisoxazole-3- carboxamido)piperidine-2-carboxylate 160 ethyl 1-(4-aminobutanoyl)-4-(5- 393.2 2.23333 cyclopropylisoxazole-3- carboxamido)piperidine-3-carboxylate 161 N-(1-(4-aminobutanoyl)-3,3- 349.3 1.25033 dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 162 N-((2S)-1-((1r,4S)-4-aminocyclohexane-1- 437.3 >10 carbonyl)-2-phenylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 163 N-((2R)-1-((1r,4R)-4-aminocyclohexane- 437.25 7.16633 1-carbonyl)-2-phenylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 164 5-cyclopropyl-N-((2R)-2-methyl-1-(2- 403.1 5.90922 methyl-2-(piperidin-4- yl)propanoyl)piperidin-4-yl)isoxazole-3- carboxamide 165 5-cyclopropyl-N-((2S)-2-methyl-1-(2- 403.1 4.73168 methyl-2-(piperidin-4- yl)propanoyl)piperidin-4-yl)isoxazole-3- carboxamide 166 5-cyclopropyl-N-((2R)-2-methyl-1-(2-(2- 389.1 0.50622 methylpiperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 167 5-cyclopropyl-N-((2R)-1-(2-(4- 391.2 0.91127 hydroxypiperidin-4-yl)acetyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 168 5-cyclopropyl-N-((2R)-1-(4- 389.1 3.17831 ethylpiperidine-4-carbonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 169 5-cyclopropyl-N-((2S)-1-(4- 389.1 3.77384 ethylpiperidine-4-carbonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 170 5-cyclopropyl-N-((2R)-1-(4- 379.1 0.6767 fluoropiperidine-4-carbonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 171 N-((2R,4R)-1-(4-aminobutanoyl)-2- 335.1 3.11011 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 172 N-((2R,4R)-1-(4-amino-3- 351.1 6.77783 hydroxybutanoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 173 N-((2S)-1-(4-amino-3-hydroxybutanoyl)- 351.1 5.26362 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 174 N-((2R)-1-((1S,3S)-3-aminocyclohexane- 375.1 0.72766 1-carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 175 N-((2R)-1-(6-aminospiro[3.3]heptane-2- 387.1 0.27354 0.98285 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 176 5-cyclopropyl-N-((2S)-2-methyl-1-(3- 375.1 0.62421 (pyrrolidin-3-yl)propanoyl)piperidin-4- yl)isoxazole-3-carboxamide 177 5-cyclopropyl-N-((2S)-1-(5- 377.2 >10 hydroxypiperidine-3-carbonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 178 5-cyclopropyl-N-((2S)-2-methyl-1-(6- 387.1 2.02272 azaspiro[3.4]octane-2-carbonyl)piperidin- 4-yl)isoxazole-3-carboxamide 179 5-cyclopropyl-N-((2S)-2-methyl-1-(6- 387.25 1.42245 azaspiro[2.5]octane-1-carbonyl)piperidin- 4-yl)isoxazole-3-carboxamide 180 5-cyclopropyl-N-((2R)-2-methyl-1-(3- 375.25 0.95346 (pyrrolidin-3-yl)propanoyl)piperidin-4- yl)isoxazole-3-carboxamide 181 N-(9-((3-aminopropyl)sulfonyl)-9- 397 0.09267 0.56598 azabicyclo[3.3.1]nonan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 182 N-(1-((1R,3S)-3-aminocyclopentane-1- 347.1 4.7946 carbonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 183 N-(1-((2-aminoethyl)sulfonyl)piperidin-4- 343 1.42123 yl)-5-cyclopropylisoxazole-3-carboxamide 184 N-((2R,4S)-1-(5-aminopentanoyl)-2- 349.2 2.67277 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 185 N-((2R,4S)-1-(benzylsulfonyl)-2- 404.15 4.30641 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 186 5-cyclopropyl-N-((2R,4S)-2-methyl-1- 396.1 >10 ((2,2,2-trifluoroethyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 187 N-((2S,4S)-1-((3-aminopropyl)sulfonyl)-2- 371.1 0.00409 0.83104 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 188 N-((2S,4R)-1-((3-aminopropyl)sulfonyl)- 371.1 0.07229 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 189 N-((2R,4R)-1-((3-aminopropyl)sulfonyl)- 371.1 0.05594 1.24113 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 190 N-((3R,4S)-1-((1r,4R)-4- 389.1 0.352 aminocyclohexane-1-carbonyl)-3- ethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 191 N-(8-((1r,4r)-4-aminocyclohexane-1- 387.2 >10 carbonyl)-8-azabicyclo[3.2.1]octan-3-yl)- 5-cyclopropylisoxazole-3-carboxamide 192 ethyl (2S)-1-((1r,4S)-4-aminocyclohexane- 433.1 7.08316 1-carbonyl)-4-(5-cyclopropylisoxazole-3- carboxamido)piperidine-2-carboxylate 193 N-((3R,4S)-1-(4-aminobutanoyl)-3- 335.2 2.86619 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 194 N-((3S,4R)-1-(4-aminobutanoyl)-3- 335.2 1.36537 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 195 N-((3R,4R)-1-(4-aminobutanoyl)-3- 335.2 >10 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 196 N-((3S,4S)-1-(4-aminobutanoyl)-3- 335.2 6.90946 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 197 N-(1-(4-aminobutanoyl)-3,3- 357.1 >10 difluoropiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 198 N-(5-(4-aminobutanoyl)-5- 347.1 0.82956 azaspiro[2.5]octan-8-yl)-5- cyclopropylisoxazole-3-carboxamide 199 N-(8-(4-aminobutanoyl)-8- 347.1 0.67809 azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 201 N-((2S)-1-(4-aminopiperidine-1- 376.1 2.22535 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 202 N-((2R)-1-(4-aminocubane-1-carbonyl)-2- 395.1 0.14195 1.30843 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 203 N-(1-((1r,4r)-4-aminocyclohexane-1- 389.25 0.37891 carbonyl)-2,3-dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 204 N-((2S)-1-(2-(1- 375.25 4.67985 (aminomethyl)cyclobutyl)acetyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 205 N-((2R)-1-(2-(1- 375.1 1.99119 (aminomethyl)cyclobutyl)acetyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 206 5-cyclopropyl-N-((2S)-2-methyl-1-(2-(3- 389.1 1.58733 methylpiperidin-4-yl)acetyl)piperidin-4- yl)isoxazole-3-carboxamide 207 5-cyclopropyl-N-((2S)-1-(4- 379.2 2.60074 fluoropiperidine-4-carbonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 208 N-((2R,4S)-1-(4-aminobutanoyl)-2- 335.1 3.81793 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 209 N-((2R,4S)-1-((3-aminopropyl)sulfonyl)- 371.15 0.1003 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 210 N-(1-((3-aminopropyl)sulfonyl)piperidin- 357.1 0.32133 2.90138 4-yl)-5-cyclopropylisoxazole-3- carboxamide 211 N-(9-(4-aminobutanoyl)-9- 361.1 5.85206 azabicyclo[3.3.1]nonan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 212 N-((2R,4R)-1-(5-aminopentanoyl)-2- 349.15 0.83765 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 213 5-cyclopropyl-N-((2R,4S)-1- 354 >10 (cyclopropylsulfonyl)-2-methylpiperidin- 4-yl)isoxazole-3-carboxamide 214 5-cyclopropyl-N-((2R,4S)-2-methyl-1-(N- 343 >10 methylsulfamoyl)piperidin-4-yl)isoxazole- 3-carboxamide 215 5-cyclopropyl-N-((2R,4S)-1-((2- (394.1) >10 methoxyethyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 216 5-cyclopropyl-N-((2R,4R)-1- 354 >10 (cyclopropylsulfonyl)-2-methylpiperidin- 4-yl)isoxazole-3-carboxamide 217 5-cyclopropyl-N-((2R,4R)-2-methyl-1-(N- 343.1 6.75805 methylsulfamoyl)piperidin-4-yl)isoxazole- 3-carboxamide 218 N-(1-((3-aminopropyl)sulfonyl)-4- 371.2 0.23041 1.4182 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 219 N-(1-(4-aminobutanoyl)-2-(tert- 377.2 6.31559 butyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 220 N-((3R,4R)-1-(4-aminobutanoyl)-3- 397.2 2.52191 phenylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 221 N-((3R,4S)-1-(4-aminobutanoyl)-3- 397.1 >10 phenylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 222 N-((2S)-1-(4-aminocubane-1-carbonyl)-2- 395.1 4.63995 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 223 5-cyclopropyl-N-((2S)-1-(2-(4- 391.1 7.18894 hydroxypiperidin-4-yl)acetyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 224 5-cyclopropyl-N-((2R)-2-methyl-1-(4- 375.15 1.41743 methylpiperidine-4-carbonyl)piperidin-4- yl)isoxazole-3-carboxamide 225 N-((2R,4S)-1-(4-amino-3- 351.1 9.0491 hydroxybutanoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 226 N-((2S)-1-(2-(3-aminocyclohexyl)acetyl)- 389.1 2.38426 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 227 N-(1-(2-(1H-imidazol-4-yl)acetyl)-2- 358.1 >10 >40 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 228 N-((2S,4S)-1-(5-aminopentanoyl)-2- 349.15 1.28279 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 229 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 356 0.8625 (propylsulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 230 5-cyclopropyl-N-((2S,4S)-1- 370.1 0.47239 (isobutylsulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 231 ethyl 2-(((2S,4S)-4-(5- 400.1 1.16807 cyclopropylisoxazole-3-carboxamido)-2- methylpiperidin-1-yl)sulfonyl)acetate 232 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 396.1 3.26173 ((2,2,2-trifluoroethyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 233 5-cyclopropyl-N-((2S,4S)-1-((2- 372 2.36218 methoxyethyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 234 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((1- 394 1.2429 methyl-1H-imidazol-4- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 235 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 418 1.33318 3.2982 (phenethylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 236 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 410.05 1.03937 ((3,3,3-trifluoropropyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide

237 5-cyclopropyl-N-((2S,4S)-1-((2- 400 3.46488 isopropoxyethyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 238 5-cyclopropyl-N-((2R,4S)-2-methyl-1- 356.05 >10 (propylsulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 239 5-cyclopropyl-N-((2R,4S)-1- 370.1 >10 (isobutylsulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 240 N-((2R,4S)-1-(butylsulfonyl)-2- 370.1 >10 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 241 N-((2R,4S)-1-((6-chloropyridin-3- 425.05 >10 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 242 5-cyclopropyl-N-((2R,4S)-2-methyl-1- 383.15 >10 (pyrrolidin-1-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 243 5-cyclopropyl-N-((2R,4S)-2-methyl-1-((4- 412.15 1.75762 methylpiperazin-1-yl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 244 N-((2S,4R)-1-(benzylsulfonyl)-2- 404 >10 14.06578 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 245 ethyl 2-(((2S,4R)-4-(5- 400.1 >10 cyclopropylisoxazole-3-carboxamido)-2- methylpiperidin-1-yl)sulfonyl)acetate 246 5-cyclopropyl-N-((2S,4R)-2-methyl-1- 396 >10 ((2,2,2-trifluoroethyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 247 5-cyclopropyl-N-((2S,4R)-1- 354.1 >10 (cyclopropylsulfonyl)-2-methylpiperidin- 4-yl)isoxazole-3-carboxamide 248 5-cyclopropyl-N-((2S,4R)-1-((2- 372.1 >10 methoxyethyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 249 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 356.1 >10 (propylsulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 250 5-cyclopropyl-N-((2R,4R)-1- 370.15 9.44683 (isobutylsulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 251 N-((2R,4R)-1-(butylsulfonyl)-2- 370.1 6.15252 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 252 ethyl 2-(((2R,4R)-4-(5- 400.05 >10 cyclopropylisoxazole-3-carboxamido)-2- methylpiperidin-1-yl)sulfonyl)acetate 253 N-((2R,4R)-1-((6-chloropyridin-3- 425.1 >10 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 254 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 383.15 4.13805 (pyrrolidin-1-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 255 5-cyclopropyl-N-((2R,4R)-2-methyl-1-((4- 412.1 1.19523 methylpiperazin-1-yl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 256 methyl 3-(((2R,4R)-4-(5- 400.1 >10 cyclopropylisoxazole-3-carboxamido)-2- methylpiperidin-1-yl)sulfonyl)propanoate 257 5-cyclopropyl-N-((2R,4R)-1-((2- 372 9.2914 methoxyethyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 258 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 410 8.37154 ((3,3,3-trifluoropropyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 259 5-cyclopropyl-N-((2R,4R)-1-((3- 386.15 >10 methoxypropyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 260 5-cyclopropyl-N-((2S,4S)-1- 341.9 2.44732 (ethylsulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 261 5-cyclopropyl-N-((2R,4R)-1- 342 >10 (ethylsulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 262 5-cyclopropyl-N-((2S,4R)-1- 342.05 >10 (ethylsulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 263 N-(1-((1r,4r)-4-aminocyclohexane-1- 389.2 0.03219 0.56899 carbonyl)-2,5-dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 264 N-((2R)-1-(2-(3-aminocyclohexyl)acetyl)- 389 0.40966 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 265 N-(2-(4-aminobutanoyl)-2- 347.1 5.44619 >40 azabicyclo[2.2.2]octan-5-yl)-5- cyclopropylisoxazole-3-carboxamide 266 N-((2S,4R)-1-(2-(1- 403.1 >10 (aminomethyl)cyclohexyl)acetyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 267 N-((2R,4S)-1-(2-(1- 403.1 8.51913 (aminomethyl)cyclohexyl)acetyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 268 N-((2R,4S)-1-(4-amino-3,3- 363.1 3.15461 dimethylbutanoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 269 N-((2S,4S)-1-(4-amino-3-benzylbutanoyl)- 425.2 >10 >40 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 270 N-((2R,4S)-1-(4-amino-3- 425.2 >10 >40 benzylbutanoyl)-2-methylpiperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 271 N-((2S,4R)-1-(4-amino-3- 425.2 >10 >40 benzylbutanoyl)-2-methylpiperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 272 N-((2R,4R)-1-(4-amino-3- 425.2 >10 >40 benzylbutanoyl)-2-methylpiperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 273 N-((2S,4R)-1-(5-aminopentanoyl)-2- 349.15 7.82701 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 274 N-((2S,4S)-1-(benzylsulfonyl)-2- (426.1) 0.43325 1.41883 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 275 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 391.05 0.1537 0.67609 (pyridin-2-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 276 5-cyclopropyl-N-((2S,4S)-1- 354 3.63356 (cyclopropylsulfonyl)-2-methylpiperidin- 4-yl)isoxazole-3-carboxamide 277 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 383 0.65372 (pyrrolidin-1-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 278 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(N- 343 2.89251 methylsulfamoyl)piperidin-4-yl)isoxazole- 3-carboxamide 279 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((4- 412 0.08154 0.26586 methylpiperazin-1-yl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 280 methyl 3-(((2S,4S)-4-(5- 400 4.85331 cyclopropylisoxazole-3-carboxamido)-2- methylpiperidin-1-yl)sulfonyl)propanoate 281 5-cyclopropyl-N-((2S,4S)-1-((3- 386 1.86694 methoxypropyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 282 methyl 3-(((2R,4S)-4-(5- 400 >10 cyclopropylisoxazole-3-carboxamido)-2- methylpiperidin-1-yl)sulfonyl)propanoate 283 5-cyclopropyl-N-((2R,4S)-2-methyl-1-((1- 394 >10 >40 methyl-1H-imidazol-4- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 284 5-cyclopropyl-N-((2R,4S)-1-((3- 386.15 >10 methoxypropyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 285 5-cyclopropyl-N-((2R,4S)-1-((2- 400 >10 isopropoxyethyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 286 5-cyclopropyl-N-((2S,4R)-2-methyl-1- 391.05 >10 10.65927 (pyridin-2-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 287 N-((2S,4R)-1-((6-chloropyridin-3- 425 >10 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 288 5-cyclopropyl-N-((2S,4R)-2-methyl-1- 383.1 >10 (pyrrolidin-1-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 289 5-cyclopropyl-N-((2S,4R)-2-methyl-1-(N- 343 >10 methylsulfamoyl)piperidin-4-yl)isoxazole- 3-carboxamide 290 methyl 3-(((2S,4R)-4-(5- 400 >10 cyclopropylisoxazole-3-carboxamido)-2- methylpiperidin-1-yl)sulfonyl)propanoate 291 5-cyclopropyl-N-((2S,4R)-2-methyl-1-((1- 394 >10 >40 methyl-1H-imidazol-4- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 292 5-cyclopropyl-N-((2S,4R)-2-methyl-1- 410 >10 ((3,3,3-trifluoropropyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 293 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 391.05 4.84236 7.19436 (pyridin-2-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 294 5-cyclopropyl-N-((2R,4R)-2-methyl-1-((1- 394 >10 >40 methyl-1H-imidazol-4- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 295 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 418.1 >10 >40 (phenethylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 296 5-cyclopropyl-N-((2R,4R)-1-((2- 400 5.96704 isopropoxyethyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 297 N-((3R,4S)-1-(4-aminobutanoyl)-3- 349.1 1.80484 ethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 298 N-((3R,4R)-1-(4-aminobutanoyl)-3- 349.1 6.09665 ethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 299 N-((3S,4R)-1-(4-aminobutanoyl)-3- 349.1 0.98944 ethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 300 N-((3S,4S)-1-(4-aminobutanoyl)-3- 349.1 3.60037 ethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 301 N-(1-(4-aminobutanoyl)-1- 389.2 6.46534 azaspiro[5.5]undecan-4-yl)-5- cyclopropylisoxazole-3-carboxamide 302 N-((2S,6R)-1-(4-aminobutanoyl)-2,6- 377.3 6.93186 diethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 303 N-(1-((1r,4r)-4-aminocyclohexane-1- 389.1 1.78233 carbonyl)-3,5-dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 304 N-(1-((1r,4r)-4-aminocyclohexane-1- 429.1 2.03567 carbonyl)-3-(trifluoromethyl)piperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 305 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 389.2 1.16784 ((S)-2-(piperidin-4-yl)propanoyl)piperidin- 4-yl)isoxazole-3-carboxamide 306 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 389.2 0.85247 ((R)-2-(piperidin-4- yl)propanoyl)piperidin-4-yl)isoxazole-3- carboxamide 307 5-cyclopropyl-N-((2R,4S)-2-methyl-1- 389.1 0.92847 ((S)-2-(piperidin-4-yl)propanoyl)piperidin- 4-yl)isoxazole-3-carboxamide 308 5-cyclopropyl-N-((2R,4S)-2-methyl-1- 389.1 0.17867 ((R)-2-(piperidin-4- yl)propanoyl)piperidin-4-yl)isoxazole-3- carboxamide 309 N-((2R,4R)-1-((1r,4R)-4- 451.3 1.18016 16.79585 aminocyclohexane-1-carbonyl)-2- benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 310 N-((2S,4S)-1-((1r,4S)-4- 451.4 0.73318 8.10326 aminocyclohexane-1-carbonyl)-2- benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 311 N-((2S,4R)-1-(4-amino-3,3- 363.1 1.61667 dimethylbutanoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 312 N-((2R,4R)-1-(4-amino-3,3- 363.1 0.4155 dimethylbutanoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 313 N-((2R,4S)-1-(4-amino-3- 411.2 5.02398 phenylbutanoyl)-2-methylpiperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 314 N-((2R,4R)-1-(4-amino-3- 411.25 4.72554 >40 phenylbutanoyl)-2-methylpiperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide

315 5-cyclopropyl-N-((2S,4S)-1-(N,N- (379.1) 1.32822 4.84171 dimethylsulfamoyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 316 N-((2S,4S)-1-(butylsulfonyl)-2- 370.2 0.23719 0.78207 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 317 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 391 0.68629 4.10919 (pyridin-3-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 318 N-((2S,4S)-1-((6-chloropyridin-3- 425.1 1.88386 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 319 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 405 1.42682 4.52678 ((pyridin-3-ylmethyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 320 ethyl 2-(((2R,4S)-4-(5- 400.05 >10 cyclopropylisoxazole-3-carboxamido)-2- methylpiperidin-1-yl)sulfonyl)acetate 321 5-cyclopropyl-N-((2R,4S)-2-methyl-1- 391 4.46652 (pyridin-2-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 322 5-cyclopropyl-N-((2S,4R)-2-methyl-1- 356 >10 (propylsulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 323 5-cyclopropyl-N-((2S,4R)-1- 370.3 >10 (isobutylsulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 324 5-cyclopropyl-N-((2S,4R)-2-methyl-1-((4- 412.2 1.64608 methylpiperazin-1-yl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 325 5-cyclopropyl-N-((2S,4R)-2-methyl-1- 405 >10 ((pyridin-3-ylmethyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 326 5-cyclopropyl-N-((2S,4R)-2-methyl-1- 418 >10 (phenethylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 327 5-cyclopropyl-N-((2S,4R)-1-((3- 386 >10 methoxypropyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 328 5-cyclopropyl-N-((2R,4R)-1-(N,N- 357.15 6.91182 15.20884 dimethylsulfamoyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 329 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 405 6.42224 20.04736 ((pyridin-3-ylmethyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 330 N-((2R,4R)-1-((4- 447.2 >10 29.32443 acetamidophenyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 331 ethyl 1-((3-aminopropyl)sulfonyl)-4-(5- 429.2 0.14739 2.30591 cyclopropylisoxazole-3- carboxamido)piperidine-3-carboxylate 332 N-(1-(4-aminobutanoyl)-3,5- 349.2 2.53113 dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 333 N-((2R,4R)-1-(4-aminobutanoyl)-2- 411.25 >10 >40 benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 334 N-((2S,4R)-1-(4-aminobutanoyl)-2- 411.25 1.89516 33.02657 benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 335 N-((2R,4S)-1-(4-aminobutanoyl)-2- 411.25 1.11818 19.61527 benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 336 N-((2S,4S)-1-(4-aminobutanoyl)-2- 411.25 0.05412 1.62405 benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 337 N-((2S,4S)-1-(4-amino-3,3- 363.1 0.96148 12.99612 dimethylbutanoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 338 N-((2S,4S)-1-(4-amino-3-phenylbutanoyl)- 411.1 0.8416 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 339 N-((2S,4R)-1-(4-amino-3- 411.1 4.66558 phenylbutanoyl)-2-methylpiperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 340 N-((2S,4S)-1-(1H-benzo[d]imidazole-5- 394.2 >10 >40 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 341 N-((2R,4R)-1-(1H-benzo[d]imidazole-5- 394.2 1.00187 6.0106 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 342 N-((2R,4R)-1-(3- 389.2 0.55215 (aminomethyl)cyclohexane-1-carbonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 343 N-((2R,4S)-1-(3- 389.25 1.06666 (aminomethyl)cyclohexane-1-carbonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 344 5-cyclopropyl-N-((2R,4S)-2-methyl-1- 418.2 >10 (phenethylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 345 5-cyclopropyl-N-((2R,4S)-2-methyl-1- 410 >10 ((3,3,3-trifluoropropyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 346 5-cyclopropyl-N-((2S,4R)-1-(N,N- 357.15 >10 dimethylsulfamoyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 347 N-((2S,4R)-1-(butylsulfonyl)-2- 370 8.02269 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 348 N-((2S,4S)-2-benzyl-1-(2-(piperidin-4- 451.1 0.02251 0.83834 yl)acetyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 349 N-((2R,4R)-2-benzyl-1-(2-(piperidin-4- 451.1 2.26536 >40 yl)acetyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 350 5-cyclopropyl-N-((2R,4S)-1- 451.2 >10 (ethylsulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 351 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 390 3.09195 7.83322 (phenylsulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 352 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 390 0.15159 0.99614 (phenylsulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 353 5-cyclopropyl-N-((2R,4S)-2-methyl-1- 390.1 3.97616 (phenylsulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 354 N-((2R,4R)-1-((3-cyanophenyl)sulfonyl)- (437.15) 1.13679 5.65265 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 355 N-((2R,4S)-1-((3-cyanophenyl)sulfonyl)- 415 0.27778 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 356 N-(1-(4-aminobutanoyl)-3- 389.2 1.21465 (trifluoromethyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 357 N-((2R)-1-((R)-3-amino-2-(4- 427.1 1.1652 hydroxybenzyl)propanoyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 358 5-cyclopropyl-N-((2S,4R)-2-methyl-1- 389.1 3.39874 ((S)-2-(piperidin-4-yl)propanoyl)piperidin- 4-yl)isoxazole-3-carboxamide 359 5-cyclopropyl-N-((2S,4R)-2-methyl-1- 389.1 1.4568 ((R)-2-(piperidin-4- yl)propanoyl)piperidin-4-yl)isoxazole-3- carboxamide 360 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 389.1 0.79171 8.2842 ((S)-2-(piperidin-4-yl)propanoyl)piperidin- 4-yl)isoxazole-3-carboxamide 361 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 389.1 1.36293 13.61968 ((R)-2-(piperidin-4- yl)propanoyl)piperidin-4-yl)isoxazole-3- carboxamide 362 5-cyclopropyl-N-((3S,4R)-3- 391.1 2.95081 (hydroxymethyl)-1-(2-(piperidin-4- yl)acetyl)piperidin-4-yl)isoxazole-3- carboxamide 363 N-((2R,4R)-1-((1r,4R)-4- 391.1 1.98513 aminocyclohexane-1-carbonyl)-2- (hydroxymethyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 364 N-((2R,4S)-1-((1r,4R)-4- 451.2 4.56731 aminocyclohexane-1-carbonyl)-2- benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 365 N-((2R,4R)-1-(3-(2-aminopropan-2- 411.3 0.45355 3.88138 yl)benzoyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 366 N-((2S,4R)-1-(3-(2-aminopropan-2- 411.25 2.75278 yl)benzoyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 367 N-((2S,4S)-1-(3-(2-aminopropan-2- 411.5 4.28845 30.57389 yl)benzoyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 368 N-((2R,4R)-1-(4-(2-aminopropan-2- 411.3 0.12223 1.0362 yl)benzoyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 369 N-((2S,4R)-1-(4-(2-aminopropan-2- (433.1) 5.87044 yl)benzoyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 370 N-((2S,4S)-1-(4-(2-aminopropan-2- 411.3 4.39381 >40 yl)benzoyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 371 N-((2R,4S)-1-(4-(2-aminopropan-2- (433.1) 4.9531 yl)benzoyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 372 N-((2S,4R)-1-(3- 389.2 5.88826 (aminomethyl)cyclohexane-1-carbonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 373 N-((2S,4S)-1-(3- 389.2 2.46688 29.7807 (aminomethyl)cyclohexane-1-carbonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 374 5-cyclopropyl-N-((2R,4S)-2-methyl-1- 405 >10 ((pyridin-3-ylmethyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 375 N-((2R,4S)-2-benzyl-1-(2-(piperidin-4- 451.3 1.82988 yl)acetyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 376 N-((2S,4R)-2-benzyl-1-(2-(piperidin-4- 451.3 1.32288 yl)acetyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 377 N-((2S,4R)-1-((4- 447.1 >10 27.64364 acetamidophenyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 378 N-((2S,4S)-1-((4- 447.2 0.57713 2.74476 acetamidophenyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 379 5-cyclopropyl-N-((2S,4R)-2-methyl-1- 390 3.35227 (phenylsulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 380 N-((2S,4R)-1-((3-cyanophenyl)sulfonyl)- (437.15) 0.32325 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 381 5-cyclopropyl-N-((2S,4S)-1-((6- 476.3 >10 >40 (isobutyl(methyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 382 N-((3R,4R)-1-((1r,4R)-4- 391.1 2.54424 aminocyclohexane-1-carbonyl)-3- (hydroxymethyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 383 5-cyclopropyl-N-((3R,4R)-3- 391.4 3.02223 (hydroxymethyl)-1-(2-(piperidin-4- yl)acetyl)piperidin-4-yl)isoxazole-3- carboxamide 384 N-((2S,4R)-1-((1r,4S)-4- 391.1 4.03559 aminocyclohexane-1-carbonyl)-2- (hydroxymethyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 385 N-((3S,4S)-1-((3-aminopropyl)sulfonyl)-3- 371 0.08821 1.22936 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 386 N-((3S,4R)-1-((3-aminopropyl)sulfonyl)- 371 0.02816 0.33952 3-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 387 N-((3R,4S)-1-((3-aminopropyl)sulfonyl)- 371.15 0.07 0.78774 3-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 388 N-((3R,4R)-1-((3-aminopropyl)sulfonyl)- 371.2 0.46245 3-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 389 N-((2S,4R)-1-((1r,4S)-4- 451.2 >10 aminocyclohexane-1-carbonyl)-2- benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 390 N-((2R,4R)-1-((3-aminopropyl)sulfonyl)- 447.2 0.4637 2.97188 2-benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 391 N-((2S,4S)-1-(2-(1- 403.2 5.72321 >10 (aminomethyl)cyclohexyl)acetyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide

392 N-((2R,4S)-1-(3-(2-aminopropan-2- 411.1 >10 yl)benzoyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 393 5-cyclopropyl-N-((2S,4S)-1-((1- 386 3.15999 methoxypropan-2-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 394 5-cyclopropyl-N-((2S,4R)-1-((2- 400.1 >10 isopropoxyethyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 395 N-((1R,3s,5S)-8-((2-aminoethyl)sulfonyl)- 369.1 0.6108 3.1641 8-azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 396 N-((1R,3r,5S)-8-((2-aminoethyl)sulfonyl)- 369.15 0.04169 0.3747 8-azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 397 N-((2R,4S)-1-((4- 447.1 >10 >10 acetamidophenyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 398 N-((2S,4S)-1-((3-cyanophenyl)sulfonyl)-2- 415 0.212 1.2065 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 399 5-cyclopropyl-N-((1R,3s,5S)-8- 402 0.83319 2.86872 (phenylsulfonyl)-8-azabicyclo[3.2.1]octan- 3-yl)isoxazole-3-carboxamide 400 5-cyclopropyl-N-((1R,3r,5S)-8- 402 4.1308 >10 (phenylsulfonyl)-8-azabicyclo[3.2.1]octan- 3-yl)isoxazole-3-carboxamide 401 5-cyclopropyl-N-(9-(phenylsulfonyl)-9- 416 0.79319 2.94997 azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 402 N-(9-((4-acetamidophenyl)sulfonyl)-9- 473.1 4.92371 >10 azabicyclo[3.3.1]nonan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 403 N-((1R,3r,5S)-8-((4- 458.9 10 >10 acetamidophenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 404 5-cyclopropyl-N-((1R,3s,5S)-8-((2-oxo- 459 1.40067 2.91816 2,3-dihydrobenzo[d]oxazol-6-yl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 405 5-cyclopropyl-N-((1R,3r,5S)-8-((2-oxo- 458.9 9.39268 >10 2,3-dihydrobenzo[d]oxazol-6-yl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 406 N-((2S,4R)-2-benzyl-1-((2-(pyrrolidin-1- 487.35 3.41263 yl)ethyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 407 N-((2R,4R)-2-benzyl-1-((2-(pyrrolidin-1- 487.1 3.81295 >10 yl)ethyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 408 N-((2R,4S)-2-benzyl-1-((2-(pyrrolidin-1- 487.1 1.14883 yl)ethyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 409 N-((2S,4R)-2-benzyl-1-((2- (525.3) >10 morpholinoethyl)sulfonyl)piperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 410 5-cyclopropyl-N-(9-((3- 467.1 6.3223 >10 morpholinopropyl)sulfonyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 411 5-cyclopropyl-N-((2S,4R)-1-((6- 476.1 >10 (isobutyl(methyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 412 5-cyclopropyl-N-((2S,4S)-1-((6-((2- 478.3 2.12299 8.22448 methoxyethyl)(methyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 413 5-cyclopropyl-N-((2S,4S)-1-((6-((2- 464.25 1.4827 4.51041 methoxyethyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 414 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((6- 533.3 0.88858 2.60848 (methyl(2- morpholinoethyl)amino)pyridin-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 415 N-((2S,4R)-1-((6-((2- 449.1 0.13482 5.61852 aminoethyl)amino)pyridin-3-yl)sulfonyl)- 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 416 5-cyclopropyl-N-(8-((piperidin-4- 0.16357 ylmethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 417 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 411 0.00307 0.0508 ((piperidin-4-ylmethyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 418 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 410.95 0.01717 0.19706 ((piperidin-4-ylmethyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 419 N-((2S,4R,5S)-1-((1r,4S)-4- 389.25 1.95467 >10 aminocyclohexane-1-carbonyl)-2,5- dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 420 N-((2R,4S,5R)-1-((1r,4R)-4- 389.2 0.01132 0.20488 aminocyclohexane-1-carbonyl)-2,5- dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 421 N-((3S,4S)-1-((1r,4S)-4- 391.1 2.51243 aminocyclohexane-1-carbonyl)-3- (hydroxymethyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 422 N-((3R,4S)-1-((1r,4R)-4- 391.1 1.9415 aminocyclohexane-1-carbonyl)-3- (hydroxymethyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 423 N-((2R,4S)-1-((3-aminopropyl)sulfonyl)- 447.2 0.25029 1.85554 2-benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 424 N-((2S,4S)-1-((3-aminopropyl)sulfonyl)-2- 447.2 0.22763 1.80492 benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 425 N-((2R,4S)-1-(1H-benzo[d]imidazole-5- 394 >10 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 426 N-((2S,4R)-1-(1H-benzo[d]imidazole-5- 394 >10 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 427 N-(1-(2-(1H-imidazol-2-yl)acetyl)-2- 358.1 >10 >10 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 428 N-((2R,4R)-1-((1H-imidazol-4- 380 0.73212 2.58364 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 429 N-((1R,3R,5S)-8-((1s,4S)-4- 387.1 0.35096 aminocyclohexane-1-carbonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 430 N-((1R,3s,5S)-8-((4- 459.2 3.65777 4.51957 acetamidophenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 431 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 522.25 >10 >10 (isonicotinamido)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 432 N-((1R,3r,5S)-8-((6-chloro-2-oxoindolin- 491.15 6.29941 >10 5-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 433 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 457 4.19179 >10 oxoindolin-5-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 434 5-cyclopropyl-N-((1R,3r,5S)-8-((2-oxo- 458 2.40802 >10 2,3-dihydro-1H-benzo[d]imidazol-5- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 435 5-cyclopropyl-N-((1R,3s,5S)-8-((2- 423.2 2.00184 5.58678 (pyrrolidin-1-yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 436 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 423.2 0.0613 0.28517 (pyrrolidin-1-yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 437 N-((2S,4S)-2-benzyl-1-((2-(pyrrolidin-1- 487.1 1.00347 4.62346 yl)ethyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 438 N-((2S,4R)-2-benzyl-1-((3- 517.35 9.17764 >10 morpholinopropyl)sulfonyl)piperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 439 N-((2R,4R)-2-benzyl-1-((3- 517.35 >10 >10 morpholinopropyl)sulfonyl)piperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 440 5-cyclopropyl-N-((1R,3s,5S)-8-((2- 439.2 >10 >10 morpholinoethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 441 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 439.25 1.61126 3.67271 morpholinoethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 442 5-cyclopropyl-N-(9-((2-(pyrrolidin-1- 437.1 1.11218 4.5508 yl)ethyl)sulfonyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 443 5-cyclopropyl-N-(9-((2- 453 >10 >10 morpholinoethyl)sulfonyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 444 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((3- 385 0.01309 0.18073 (methylamino)propyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 445 N-(5-((3-aminopropyl)sulfonyl)-5- 397 0.13047 azaspiro[3.5]nonan-8-yl)-5- cyclopropylisoxazole-3-carboxamide 446 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((6- 420.2 0.89031 2.25375 (methylamino)pyridin-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 447 5-cyclopropyl-N-((2R,4S)-2-methyl-1-((6- 420 >10 (methylamino)pyridin-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 448 5-cyclopropyl-N-((2S,4R)-2-methyl-1-((6- 420.1 >10 (methylamino)pyridin-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 449 5-cyclopropyl-N-((2R,4R)-2-methyl-1-((6- 420 >10 >10 (methylamino)pyridin-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 450 5-cyclopropyl-N-((2S,4S)-1-((6- 462.1 1.09589 3.47813 (isobutylamino)pyridin-3-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 451 5-cyclopropyl-N-((2R,4S)-1-((6- 462.1 >10 (isobutylamino)pyridin-3-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 452 5-cyclopropyl-N-((2S,4R)-1-((6- 462.1 >10 (isobutylamino)pyridin-3-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 453 5-cyclopropyl-N-((2R,4R)-1-((6- 462.1 7.19308 >10 (isobutylamino)pyridin-3-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 454 5-cyclopropyl-N-((2R,4R)-1-((6- 476.3 >10 >10 (isobutyl(methyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 455 5-cyclopropyl-N-((2R,4R)-1-((6-((2- 478.25 >10 >10 methoxyethyl)(methyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 456 5-cyclopropyl-N-((2R,4S)-1-((6-((2- 464 >10 methoxyethyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 457 5-cyclopropyl-N-((2R,4R)-1-((6-((2- 464.25 >10 >10 methoxyethyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 458 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((6- 519.3 0.13177 0.58095 ((2-morpholinoethyl)amino)pyridin-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 459 5-cyclopropyl-N-((2R,4R)-2-methyl-1-((6- 519.35 2.35941 4.57896 ((2-morpholinoethyl)amino)pyridin-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 460 5-cyclopropyl-N-((2R,4R)-2-methyl-1-((6- 533.3 >10 >10 (methyl(2- morpholinoethyl)amino)pyridin-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3-

carboxamide 461 N-((2S,4S)-1-((6-((2- 463.25 0.01418 3.85496 aminoethyl)(methyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 462 N-((2S,4R)-1-((6-((2- 463.3 0.3055 aminoethyl)(methyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 463 N-((2R,4R)-1-((6-((2- 463 0.16261 4.33037 aminoethyl)(methyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 464 N-((2R,4R)-1-((6-((2- 449.25 0.08973 3.30448 aminoethyl)amino)pyridin-3-yl)sulfonyl)- 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 465 5-cyclopropyl-N-(9-((6- 488.1 3.11956 6.16422 (isobutylamino)pyridin-3-yl)sulfonyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 466 N-((2S,4S)-1-((5-chloropyridin-2- 424.9 0.12114 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 467 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((2- 420.3 3.73627 5.75977 (methylamino)pyridin-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 468 methyl 1-((1r,4r)-4-aminocyclohexane-1- 433.2 1.22465 carbonyl)-4-(5-cyclopropylisoxazole-3- carboxamido)-5-methylpiperidine-3- carboxylate 469 N-(1-((1r,4r)-4-aminocyclohexane-1- 437.2 6.27588 carbonyl)-3-phenylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 470 N-(1-((3-aminopropyl)sulfonyl)-3- 433.1 2.7581 phenylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 471 methyl 1-(4-aminobutanoyl)-4-(5- 393.1 5.75922 cyclopropylisoxazole-3-carboxamido)-5- methylpiperidine-3-carboxylate 472 5-cyclopropyl-N-(9-((2- 502.2 >10 (isobutyl(methyl)amino)pyridin-3- yl)sulfonyl)-9-azabicyclo[3.3.1]nonan-3- yl)isoxazole-3-carboxamide 473 5-cyclopropyl-N-(9-((2- 488.1 5.97434 (isobutylamino)pyridin-3-yl)sulfonyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 474 5-cyclopropyl-N-((2S,4S)-1-((2- 462.2 2.73729 (isobutylamino)pyridin-3-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 475 N-((2S,4S)-1-((2-((2- 449 0.08652 1.34483 aminoethyl)amino)pyridin-3-yl)sulfonyl)- 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 476 N-(9-((2-((2-aminoethyl)amino)pyridin-3- 475 1.30942 yl)sulfonyl)-9-azabicyclo[3.3.1]nonan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 477 N-((2S,4S)-1-((3- 433.2 0.93164 3.26041 carbamoylphenyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 478 N-((2S,4S)-1-(4-benzylpiperazine-1- 452.3 >10 >10 carbonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 479 N-((2R,4R)-1-(4-(1- 424.1 0.28891 2.02944 aminocyclobutyl)benzoyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 480 N-((2R)-1-((3-aminopropyl)sulfonyl)-2- 433.1 0.06583 2.23715 phenylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 481 N-((2S)-1-((3-aminopropyl)sulfonyl)-2- 433.1 0.47891 4.47317 phenylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 482 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 384 0.92833 2.83154 ((tetrahydrofuran-3-yl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 483 N-((2S,4S)-1-((1H-imidazol-4- 380 0.53253 2.12754 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 484 N-((1R,3s,5S)-8-((3- 383.15 0.0792 1.44334 aminopropyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 485 N-((1R,3r,5S)-8-((3- 383.2 0.00507 0.12898 aminopropyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 486 N-((1R,3S,5S)-8-((1s,4S)-4- 387.2 >10 aminocyclohexane-1-carbonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 487 5-cyclopropyl-N-((1R,3r,5S)-8- 395 (pyrrolidin-3-ylsulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 488 5-cyclopropyl-N-(9-((piperidin-3- 437.1 0.04505 0.85719 ylmethyl)sulfonyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 489 5-cyclopropyl-N-((1R,3s,5S)-8-((4- 522.1 5.41877 6.66386 (isonicotinamido)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 490 N-((1R,3s,5S)-8-((6-chloro-2-oxoindolin- 491.15 9.23127 >10 5-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 491 N-((1R,3s,5S)-8-((5-chloro-2-oxo-2,3- 493.15 >10 >10 dihydrobenzo[d]oxazol-6-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 492 N-((1R,3r,5S)-8-((5-chloro-2-oxo-2,3- 493.15 >10 dihydrobenzo[d]oxazol-6-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 493 5-cyclopropyl-N-((1R,3s,5S)-8-((2- 457 0.84167 2.74654 oxoindolin-5-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 494 5-cyclopropyl-N-((1R,3s,5S)-8-((2-oxo- 458 5.18222 2,3-dihydro-1H-benzo[d]imidazol-5- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 495 5-cyclopropyl-N-((1R,3s,5S)-8-((3- 453.25 >10 >10 morpholinopropyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 496 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 453.25 0.16199 0.85436 morpholinopropyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 497 N-((2S,4S)-2-benzyl-1-((3- 517.35 >10 >10 morpholinopropyl)sulfonyl)piperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 498 N-((2R,4S)-2-benzyl-1-((3- 517.35 9.95967 >10 morpholinopropyl)sulfonyl)piperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 499 N-((2R,4S)-2-benzyl-1-((2- 503.1 >10 >10 morpholinoethyl)sulfonyl)piperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 500 N-((2S,4S)-1-((3- 461.1 0.00813 0.10571 (benzylamino)propyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 501 N-((2R,4S)-1-((3-aminopropyl)sulfonyl)- 399.1 4.48798 2-isopropylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 502 N-((2S,4R)-1-((3-aminopropyl)sulfonyl)- 399.1 0.76582 >10 2-isopropylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 503 N-((2R,4R)-1-((3-aminopropyl)sulfonyl)- 399.1 1.06393 >10 2-isopropylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 504 5-cyclopropyl-N-((2R,4S)-1-((6-((2- 478.1 >10 >10 methoxyethyl)(methyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 505 5-cyclopropyl-N-((2S,4R)-1-((6-((2- 464 >10 >10 methoxyethyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 506 5-cyclopropyl-N-((2R,4S)-2-methyl-1-((6- 519.35 3.96727 >10 ((2-morpholinoethyl)amino)pyridin-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 507 5-cyclopropyl-N-((2S,4R)-2-methyl-1-((6- 519.35 5.54025 >10 ((2-morpholinoethyl)amino)pyridin-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 508 N-((2R,4S)-1-((6-((2- 463 0.31958 aminoethyl)(methyl)amino)pyridin-3- yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 509 N-((2S,4S)-1-((6-((2- 449.1 0.00592 aminoethyl)amino)pyridin-3-yl)sulfonyl)- 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 510 5-cyclopropyl-N-((2S,4S)-1-((2- 476.3 >10 (isobutyl(methyl)amino)pyridin-4- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 511 5-cyclopropyl-N-((2S,4R)-1-((2- 476.3 >10 (isobutyl(methyl)amino)pyridin-4- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 512 N-((2R,4S)-1-((2-((2- 463.25 0.4872 aminoethyl)(methyl)amino)pyridin-4- yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 513 N-((2S,4S)-1-((6-cyanopyridin-3- 416.1 1.09324 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 514 5-cyclopropyl-N-(9-((6- 502.2 >10 (isobutyl(methyl)amino)pyridin-3- yl)sulfonyl)-9-azabicyclo[3.3.1]nonan-3- yl)isoxazole-3-carboxamide 515 N-(9-((6-((2-aminoethyl)amino)pyridin-3- 475.2 0.01762 yl)sulfonyl)-9-azabicyclo[3.3.1]nonan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 516 N-(9-((6-((3-aminopropyl)amino)pyridin- 489.1 0.07423 3-yl)sulfonyl)-9-azabicyclo[3.3.1]nonan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 517 N-(9-((6-((3- 503.2 0.08028 aminopropyl)(methyl)amino)pyridin-3- yl)sulfonyl)-9-azabicyclo[3.3.1]nonan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 518 5-cyclopropyl-N-((2S,4S)-1-(N,N- 385.1 3.7176 diethylsulfamoyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 519 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((6- 0.20407 (trifluoromethyl)pyridin-2- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 520 N-((2S,4S)-1-((6-((3- 463.25 0.05007 aminopropyl)amino)pyridin-2- yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 521 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((6- 533.2 4.50489 (methyl(2- morpholinoethyl)amino)pyridin-2- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 522 N-((2S,4S)-1-((6-aminopyridin-3- 406 0.40714 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 523 N-((2S,4S)-1-((2-aminopyridin-3- 406 1.0836 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 524 5-cyclopropyl-N-(9-((2- 446.2 1.84758 (methylamino)pyridin-3-yl)sulfonyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 525 N-((1R,3r,5S)-8-((4- 423.3 0.0008 0.009 aminocyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 526 5-cyclopropyl-N-((1R,3r,5S)-8- 437.25 0.001 0.015 ((piperidin-4-ylmethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 527 5-cyclopropyl-N-((1R,3r,5S)-8-(piperazin- 410.0 0.003 0.032 1-ylsulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide *IC.sub.50 values are an average of n = 1 to n = 50

TABLE-US-00005 TABLE 2A LCMS SMYD3 SMYD3 M + H Biochem Cell Cpd. or IC.sub.50 IC.sub.50 No. Chemical Name (M + Na) (.mu.M)* (.mu.M)* 528 5-cyclopropyl-N-((1R,3r,5S)-8-(((1-(4,4,4- 533 0.0006 0.0231 trifluorobutyl)piperidin-4- yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 529 N-((2S,4S)-1-((4-aminopiperidin-1- 412 0.0008 0.0152 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 530 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 515.1 0.0009 0.0239 (((1-phenethylpiperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 531 5-cyclopropyl-N-((1R,3r,5S)-8-(((1-(2- 467 0.0009 0.0331 hydroxyethyl)piperidin-4- yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 532 N-((1R,3r,5S)-8-((4-aminopiperidin-1- 424 0.0009 0.0214 yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 533 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 425 0.0010 0.0308 (((1-methylpiperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 534 5-cyclopropyl-N-((1R,3r,5S)-8-(((1-(3- 481 0.0011 0.0277 hydroxypropyl)piperidin-4- yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 535 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((4- 426 0.0012 0.0212 (methylamino)piperidin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 536 N-((1R,3r,5S)-8-(((1-benzylpiperidin-4- 513 0.0012 0.0580 yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 537 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 515.05 0.0013 0.0725 (((1-phenethylpiperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 538 5-cyclopropyl-N-((2S,4S)-1-(((1-(2- 455 0.0013 0.0294 hydroxyethyl)piperidin-4- yl)methyl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 539 N-((1R,3R,5S)-8-(((1r,4R)-4- 423.05 0.0013 0.0134 aminocyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 540 N-((1R,3R,5S)-8-(((1s,4S)-4- 423 0.0013 0.0152 aminocyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 541 N-((2S,4S)-1-((4-(2-aminopropan-2- 447 0.0014 0.0259 yl)phenyl)sulfonyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 542 5-cyclopropyl-N-((1R,3r,5S)-8-(((1-(3- 495 0.0016 0.0496 methoxypropyl)piperidin-4- yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 543 5-cyclopropyl-N-((1R,3r,5S)-8- 423.2 0.0018 0.0445 ((piperidin-4-ylmethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 544 N-((2S,4S)-1-(((1-benzylpiperidin-4- 501.1 0.0019 0.0447 yl)methyl)sulfonyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 545 5-cyclopropyl-N-((2S,4S)-1-((4- 440 0.0020 0.0399 (dimethylamino)piperidin-1-yl)sulfonyl)- 2-methylpiperidin-4-yl)isoxazole-3- carboxamide 546 N-((2S,4S)-1-((4-(benzylamino)piperidin- 502 0.0021 0.0360 1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 547 5-cyclopropyl-N-((1R,3r,5S)-8- 423.3 0.0023 0.0704 ((piperidin-3-ylmethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 548 N-((2S,4S)-1-((4-aminobutyl)sulfonyl)-2- 385 0.0024 0.0941 methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 549 5-cyclopropyl-N-((1R,3r,5S)-8-(((1-(2- 534 0.0025 0.3124 (piperidin-1-yl)ethyl)piperidin-4- yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 550 5-cyclopropyl-N-((2S,4S)-1-(((1- 453.05 0.0026 0.1685 isopropylpiperidin-4-yl)methyl)sulfonyl)- 2-methylpiperidin-4-yl)isoxazole-3- carboxamide 551 5-cyclopropyl-N-((1R,3r,5S)-8-(((1-(3,3,3- 519 0.0029 0.0542 trifluoropropyl)piperidin-4- yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 552 N-((1R,3r,5S)-8-((6-amino-2- 436 0.0031 0.0492 azaspiro[3.3]heptan-2-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 553 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 522.15 0.0034 0.1059 (((1-(2-(piperidin-1-yl)ethyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 554 5-cyclopropyl-N-((2S,4S)-1-(((1-(2- 469.1 0.0035 0.0704 methoxyethyl)piperidin-4- yl)methyl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 555 N-((2S,4S)-1-((3,8- 424 0.0037 0.0239 diazabicyclo[3.2.1]octan-3-yl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 556 5-cyclopropyl-N-((1R,3r,5S)-8-(((1-(2- 481 0.0039 0.0557 methoxyethyl)piperidin-4- yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 557 5-cyclopropyl-N-((2S,4S)-1-(((1- 467.1 0.0042 0.2607 isobutylpiperidin-4-yl)methyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 558 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 398.2 0.0043 0.0719 (piperazin-1-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 559 N-((1R,3r,5S)-8-((2,7- 450 0.0047 0.0319 diazaspiro[3.5]nonan-2-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 560 5-cyclopropyl-N-((1R,3r,5S)-8-((8- 450 0.0048 0.0516 methyl-3,8-diazabicyclo[3.2.1]octan-3- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 561 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((4- 399 0.0051 (methylamino)butyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 562 5-ethyl-N-((1R,3r,5S)-8-((piperidin-4- 411 0.0052 0.0615 ylmethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 563 5-cyclopropyl-N-((1R,3r,5S)-8-((3-((2- 440 0.0053 0.3386 (methylamino)ethyl)amino)propyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 564 N-((1R,3r,5S)-8-((3-((2- 426 0.0053 0.1660 aminoethyl)amino)propyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 565 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((8- 438 0.0060 0.0494 methyl-3,8-diazabicyclo[3.2.1]octan-3- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 566 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((3- 529 0.0061 0.3222 ((4- (trifluoromethyl)benzyl)amino)propyl)sulfonyl)piperidin- 4-yl)isoxazole-3- carboxamide 567 N-((3S,4R)-1-((4-aminopiperidin-1- 412 0.0061 0.1131 yl)sulfonyl)-3-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 568 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 425.1 0.0063 0.1559 (((1-methylpiperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 569 5-cyclopropyl-N-((1R,3R,5S)-8-((((R)- 423 0.0066 0.0394 piperidin-3-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 570 N-((2S,4S)-1-((2,5- 410 0.0067 0.0839 diazabicyclo[2.2.1]heptan-2-yl)sulfonyl)- 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 571 N-((1R,3r,5S)-8-((3,6- 422 0.0075 0.0992 diazabicyclo[3.1.1]heptan-3-yl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 572 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 412 0.0078 0.0536 (((S)-3-methylpiperazin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 573 N-((2R,4R)-1-(((1-benzylpiperidin-4- 501.1 0.0080 0.2933 yl)methyl)sulfonyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 574 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((1- 411 0.0080 0.1047 methylpiperidin-4-yl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 575 5-cyclopropyl-N-((1R,3S,5S)-8-((((S)- 423 0.0080 0.0674 piperidin-3-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 576 5-cyclopropyl-N-((2S,4S)-1-((4- 413 0.0081 0.1064 (dimethylamino)butyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 577 N-((2S,4S)-1-((2,5- 424 0.0092 0.1342 diazabicyclo[2.2.2]octan-2-yl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 578 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((3- 511 0.0094 0.2887 ((naphthalen-2- ylmethyl)amino)propyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 579 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 522.15 0.0095 0.5871 (((1-(2-(piperidin-1-yl)ethyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 580 N-((1R,3r,5S)-8-((2,6- 422 0.0097 0.0889 diazaspiro[3.3]heptan-2-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 581 5-cyclopropyl-N-((2S,4S)-1-((4- 454 0.0101 0.1429 (isopropylamino)piperidin-1-yl)sulfonyl)- 2-methylpiperidin-4-yl)isoxazole-3- carboxamide 582 5-cyclopropyl-N-((1R,3r,5S)-8-((6- 436 0.0101 0.1513 methyl-3,6-diazabicyclo[3.1.1]heptan-3- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 583 5-cyclopropyl-N-((2R,4R)-1-(((1-(2- 469.1 0.0104 0.2343 methoxyethyl)piperidin-4- yl)methyl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 584 5-cyclopropyl-N-((2S,4S)-1-(((S)-3- 426 0.0105 0.1586 ethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 585 N-((2S,4S)-1-((1,4-diazepan-1- 412 0.0106 0.1857 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 586 N-((1R,3r,5S)-8-((3-((2- 440 0.0107 0.2627 aminoethyl)(methyl)amino)propyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 587 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 524.1 0.0107 0.3105 (((1-(2-morpholinoethyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 588 N-((2S,4S)-1-((3,6- 410 0.0108 0.1505 diazabicyclo[3.1.1]heptan-3-yl)sulfonyl)- 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 589 5-cyclopropyl-N-((2R,4R)-1-(((1-(2- 455 0.0109 0.1525 hydroxyethyl)piperidin-4-

yl)methyl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 590 5-cyclopropyl-N-((1R,3r,5S)-8-((3-((2- 454 0.0109 0.1751 (dimethylamino)ethyl)amino)propyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 591 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 397 0.0111 0.1498 (methylamino)propyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 592 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 424 0.0116 0.1061 (((1S,4S)-5-methyl-2,5- diazabicyclo[2.2.1]heptan-2- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 593 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 411 0.0118 0.1472 (dimethylamino)propyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 594 N-((1R,3r,5S)-8-(N-(2- 436 0.0120 0.6692 azaspiro[3.3]heptan-6-yl)sulfamoyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 595 5-cyclopropyl-N-((2R,4S,5R)-2,5- 412 0.0126 0.0778 dimethyl-1-(piperazin-1- ylsulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 596 N-((1R,3r,5S)-8-((2-((2- 412 0.0128 0.3792 aminoethyl)amino)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 597 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 437 0.0129 0.2169 (pyrrolidin-1-yl)propyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 598 N-((1R,3r,5S)-8-((2-((2- 426 0.0131 0.4308 aminoethyl)(methyl)amino)ethyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 599 5-cyclopropyl-N-((1R,3r,5S)-8-((2-((2- 440 0.0135 0.2131 (dimethylamino)ethyl)amino)ethyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 600 5-cyclopropyl-N-((1R,3r,5S)-8-((3,3- 438 0.0135 0.1184 dimethylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 601 N-((2S,4R,5S)-1-((3- 385 0.0143 0.3334 aminopropyl)sulfonyl)-2,5- dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 602 N-((1R,3r,5S)-8-((3,8- 436 0.0145 0.1319 diazabicyclo[3.2.1]octan-8-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 603 5-cyclopropyl-N-((1R,3r,5S)-8-((2-((2- 454 0.0147 0.2390 (dimethylamino)ethyl)(methyl)amino)ethyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 604 5-cyclopropyl-N-((1R,3r,5S)-8-((3-((2- 441 0.0162 0.1999 methoxyethyl)amino)propyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 605 5-cyclopropyl-N-((1R,3r,5S)-8-((2-((2- 426 0.0175 0.3023 (methylamino)ethyl)amino)ethyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole- 3-carboxamide 606 5-cyclopropyl-N-((1R,3r,5S)-8-(N-methyl- 452 0.0177 0.2351 N-(1-methylpiperidin-4-yl)sulfamoyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 607 5-cyclopropyl-N-((2R,4R)-1-(((1- 453.05 0.0178 1.1728 isopropylpiperidin-4-yl)methyl)sulfonyl)- 2-methylpiperidin-4-yl)isoxazole-3- carboxamide 608 5-cyclopropyl-N-((3S,4R)-1-(((1-(3- 469 0.0178 0.2246 hydroxypropyl)piperidin-4- yl)methyl)sulfonyl)-3-methylpiperidin-4- yl)isoxazole-3-carboxamide 609 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((3- 529 0.0188 0.4514 ((3- (trifluoromethyl)benzyl)amino)propyl)sulfonyl)piperidin- 4-yl)isoxazole-3- carboxamide 610 5-cyclopropyl-N-((1R,3r,5S)-8-((3-((2- 468 0.0194 0.3325 (dimethylamino)ethyl)(methyl)amino)propyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 611 5-cyclopropyl-N-((2R,4R)-1-(((1- 467.1 0.0200 1.0292 isobutylpiperidin-4-yl)methyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 612 N-((2S,4S)-1-((3- 467 0.0207 0.2172 ((cyclohexylmethyl)amino)propyl)sulfonyl)- 2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 613 5-cyclopropyl-N-((3S,4R)-3-methyl-1- 521 0.0209 0.2124 (((1-(4,4,4-trifluorobutyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 614 N-((3S,4R)-1-((4-(benzylamino)piperidin- 502 0.0212 0.3043 1-yl)sulfonyl)-3-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 615 N-((2S,4S)-1-((3,8- 424 0.0217 0.2333 diazabicyclo[3.2.1]octan-8-yl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 616 5-cyclopropyl-N-((2R,4R)-2-methyl-1-(4- 437 0.0219 0.5949 (piperidin-3-yl)benzoyl)piperidin-4- yl)isoxazole-3-carboxamide 617 5-cyclopropyl-N-((2S,4S)-1-((4- 426 0.0228 0.1832 ethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 618 5-cyclopropyl-N-((3S,4R)-3-methyl-1- 411 0.0232 0.2196 ((piperidin-4-ylmethyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 619 5-cyclopropyl-N-((1R,3r,5S)-8-(((1-(2- 536 0.0232 0.5921 morpholinoethyl)piperidin-4- yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 620 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 440 0.0233 0.3392 (methyl(2- (methylamino)ethyl)amino)ethyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole- 3-carboxamide 621 5-cyclopropyl-N-((3S,4R)-3-methyl-1- 398 0.0234 0.2226 (piperazin-1-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 622 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 454 0.0234 0.4635 (methyl(2- (methylamino)ethyl)amino)propyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 623 5-cyclopropyl-N-((3S,4R)-1-(((1-(2- 455 0.0237 0.2310 hydroxyethyl)piperidin-4- yl)methyl)sulfonyl)-3-methylpiperidin-4- yl)isoxazole-3-carboxamide 624 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 412 0.0246 0.2837 (((S)-2-methylpiperazin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 625 5-cyclopropyl-N-((3S,4R)-3-methyl-1- 425 0.0253 0.2236 (((1-methylpiperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 626 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 424 0.0253 0.1569 (((1R,4R)-5-methyl-2,5- diazabicyclo[2.2.1]heptan-2- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 627 N-((3S,4R)-1-((4-(2-aminopropan-2- 447 0.0265 0.2431 yl)phenyl)sulfonyl)-3-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 628 N-((2S,4R,5S)-1-((3- 475 0.0273 0.5767 (benzylamino)propyl)sulfonyl)-2,5- dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 629 5-cyclopropyl-N-((2R,4S,5R)-2,5- 425 0.0282 0.4070 dimethyl-1-((piperidin-4- ylmethyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 630 5-cyclopropyl-N-((2S,4S)-1-((3- 425 0.0294 0.3965 ((cyclopropylmethyl)amino)propyl)sulfonyl)- 2-methylpiperidin-4-yl)isoxazole-3- carboxamide 631 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((5- 438 0.0298 0.2985 methyl-2,5-diazabicyclo[2.2.2]octan-2- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 632 5-cyclopropyl-N-((2S,4R,5S)-2,5- 425 0.0304 0.2286 dimethyl-1-((piperidin-4- ylmethyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 633 5-cyclopropyl-N-((2S,4S)-1-((3- 413 0.0304 0.2912 (isopropylamino)propyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 634 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 412 0.0318 0.1755 (((R)-3-methylpiperazin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 635 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((3- 441 0.0325 0.3179 (neopentylamino)propyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 636 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 438 0.0332 0.3652 ethylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 637 5-cyclopropyl-N-((2S,4R,5S)-2,5- 412 0.0334 0.2032 dimethyl-1-(piperazin-1- ylsulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 638 5-cyclopropyl-N-((2S,4S)-1-((3,3- 426 0.0337 0.2535 dimethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 639 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((4- 426 0.0348 0.2575 methyl-1,4-diazepan-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 640 5-cyclopropyl-N-((2S,4S)-1-((3- 427 0.0357 0.4801 (isobutylamino)propyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 641 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 424 0.0363 0.1881 methylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 642 N-((2R,4S,5R)-1-((3- 385 0.0376 0.5708 aminopropyl)sulfonyl)-2,5- dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 643 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 440 0.0378 0.2106 (hydroxymethyl)piperazin-1-yl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 644 5-cyclopropyl-N-((2R,4R)-2-methyl-1-(4- 437 0.0413 0.3031 (piperidin-4-yl)benzoyl)piperidin-4- yl)isoxazole-3-carboxamide 645 N-((2S,4S)-1-((3- 537 0.0444 0.5754 (benzhydrylamino)propyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 646 5-cyclopropyl-N-((3S,4R)-3-methyl-1-(N- 412 0.0452 0.7547 (piperidin-4-yl)sulfamoyl)piperidin-4- yl)isoxazole-3-carboxamide 647 N-((2S,4S)-2-benzyl-1-((piperidin-4- 487 0.0455 0.8087 ylmethyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 648 5-cyclopropyl-N-((3S,4R)-1-(((1-(3- 483 0.0468 0.3307 methoxypropyl)piperidin-4- yl)methyl)sulfonyl)-3-methylpiperidin-4- yl)isoxazole-3-carboxamide 649 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 383 0.0472 0.2614 (methylamino)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 650 N-((2S,4S)-1-(N-(2- 0.0491 4.6303 aminoethyl)sulfamoyl)-2-methylpiperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide 651 5-cyclopropyl-N-((1R,3r,5S)-8-((2-(3- 466 0.0506 0.5325 (dimethylamino)pyrrolidin-1- yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 652 5-cyclopropyl-N-((2R,4S)-2-methyl-1- 398 0.0511 0.3391 (piperazin-1-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide

653 5-cyclopropyl-N-((3S,4R)-3-methyl-1-(N- 426 0.0550 0.3278 methyl-N-(piperidin-4- yl)sulfamoyl)piperidin-4-yl)isoxazole-3- carboxamide 654 5-cyclopropyl-N-((3S,4R)-1-(((1-(2- 469 0.0560 0.3397 methoxyethyl)piperidin-4- yl)methyl)sulfonyl)-3-methylpiperidin-4- yl)isoxazole-3-carboxamide 655 N-((3S,4R)-1-(((1-benzylpiperidin-4- 501 0.0564 0.4969 yl)methyl)sulfonyl)-3-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 656 5-cyclopropyl-N-((1R,3r,5S)-8-((3,3,4- 452 0.0598 0.4406 trimethylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 657 N-((2R,4S,5R)-1-(4-(2-aminopropan-2- 425 0.0634 0.6340 yl)benzoyl)-2,5-dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 658 5-cyclopropyl-N-((2R,4R)-2-methyl-1-(4- 452 0.0647 1.3988 (piperazin-1-ylmethyl)benzoyl)piperidin- 4-yl)isoxazole-3-carboxamide 659 N-((1R,3r,5S)-8-(N-(1-benzylpiperidin-4- 528 0.0664 0.5776 yl)-N-methylsulfamoyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 660 5-cyclopropyl-N-((1R,3r,5S)-8-((3,4- 438 0.0667 0.4140 dimethylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 661 5-cyclopropyl-N-((2S,4S)-1-(((2S,5R)- 426 0.0773 0.4903 2,5-dimethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 662 N-((2S,4S)-2-benzyl-1-(((1-(2- 531 0.0801 1.5480 hydroxyethyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 663 5-cyclopropyl-N-((1R,3r,5S)-8-((2-(3- 506 0.0851 0.6705 (piperidin-1-yl)pyrrolidin-1- yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 664 N-((2R,4R)-1-(4-((R)-1- 397 0.0866 1.0654 aminoethyl)benzoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 665 5-cyclopropyl-N-((1R,3r,5S)-8-((3-((2- 455 0.0868 methoxyethyl)(methyl)amino)propyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 666 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 412 0.0906 0.8014 (((R)-2-methylpiperazin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 667 5-cyclopropyl-N-((3S,4R)-3-methyl-1-(N- 426 0.0969 0.7306 (1-methylpiperidin-4- yl)sulfamoyl)piperidin-4-yl)isoxazole-3- carboxamide 668 5-cyclopropyl-N-((3S,4R)-3-methyl-1-(N- 440 0.1009 0.5763 methyl-N-(1-methylpiperidin-4- yl)sulfamoyl)piperidin-4-yl)isoxazole-3- carboxamide 669 5-cyclopropyl-N-((2S,4S)-1-(((R)-3,4- 426 0.1020 0.3984 dimethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 670 5-cyclopropyl-N-((1R,3r,5S)-8-((3-((2- 496 0.1027 0.8858 morpholinoethyl)amino)propyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 671 N-((2R,4R)-1-(4-(2- 413 0.1035 5.5778 aminoethoxy)benzoyl)-2-methylpiperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide 672 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 397 0.1043 0.3883 (dimethylamino)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 673 5-cyclopropyl-N-((1R,3r,5S)-9- 437 0.1061 1.6774 ((piperidin-4-ylmethyl)sulfonyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 674 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(N- 440 0.1083 1.0760 methyl-N-(1-methylpiperidin-4- yl)sulfamoyl)piperidin-4-yl)isoxazole-3- carboxamide 675 5-cyclopropyl-N-((2R,4R)-2-methyl-1-(4- 397 0.1105 1.3732 ((methylamino)methyl)benzoyl)piperidin- 4-yl)isoxazole-3-carboxamide 676 5-cyclopropyl-N-((2R,4R)-2-methyl-1- 524.15 0.1112 >10.0000 (((1-(2-morpholinoethyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 677 N-((2S,4S)-1-(N-(2-aminoethyl)-N- 386 0.1112 5.3131 methylsulfamoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 678 5-cyclopropyl-N-((1R,3r,5S)-9-(N-methyl- 452 0.1131 2.6583 N-(piperidin-4-yl)sulfamoyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 679 N-((2R,4R)-1-(4-((S)-1- 397 0.1132 1.2977 aminoethyl)benzoyl)-2-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide 680 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 440 0.1187 0.5921 ((3,3,4-trimethylpiperazin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 681 N-((2R,4S,5R)-1-((3- 474 0.1195 0.9296 (benzylamino)propyl)sulfonyl)-2,5- dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 682 N-((2S,4S)-2-benzyl-1-(((1- 501 0.1211 1.2477 methylpiperidin-4- yl)methyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 683 5-cyclopropyl-N-((2R,4R)-2-methyl-1-(6- 439 0.1217 1.7798 (piperazin-1-yl)nicotinoyl)piperidin-4- yl)isoxazole-3-carboxamide 684 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 454 0.1225 0.9230 (hydroxymethyl)-4-methylpiperazin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 685 5-cyclopropyl-N-((2R,4S,5R)-2,5- 426 0.1244 0.2542 dimethyl-1-((4-methylpiperazin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 686 5-cyclopropyl-N-((2R,4R)-1-(4- 411 0.1289 1.5414 ((dimethylamino)methyl)benzoyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 687 5-cyclopropyl-N-((1R,3s,5S)-9-(N- 452 0.1302 1.7075 methyl-N-(piperidin-4-yl)sulfamoyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 688 N-((2R,4S,5R)-1-((2- 371 0.1306 0.7834 aminoethyl)sulfonyl)-2,5- dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 689 5-cyclopropyl-N-((1R,3r,5S)-8-((2-(2- 437 0.1307 0.7636 methylpyrrolidin-1-yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 690 5-cyclopropyl-N-((1R,3r,5S)-8-((2-(3- 439 0.1376 0.5532 hydroxypyrrolidin-1-yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 691 N-((2R,4S)-2-benzyl-1-((piperidin-4- 487 0.1440 1.9453 ylmethyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 692 5-cyclopropyl-N-((1R,3r,5S)-8-((3,5- 438 0.1482 0.6374 dimethylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 693 5-cyclopropyl-N-((3S,4R)-3-methyl-1- 522 0.1556 4.0418 (((1-(2-(piperidin-1-yl)ethyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 694 N-((2S,4R,5S)-1-((2- 371 0.1570 0.9523 aminoethyl)sulfonyl)-2,5- dimethylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 695 N-((2S,4S)-1-((3-amino-1- 447 0.1686 1.8333 phenylpropyl)sulfonyl)-2-methylpiperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide 696 N-((3S,4R)-1-(N-(1-benzylpiperidin-4- 502 0.1703 1.5473 yl)sulfamoyl)-3-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 697 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((3- 447 0.1777 1.5607 (phenylamino)propyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 698 5-cyclopropyl-N-((3S,4R)-3-methyl-1- 507 0.1790 0.7457 (((1-(3,3,3-trifluoropropyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 699 5-cyclopropyl-N-((2S,4S)-1-((3,4- 426 0.1930 0.6578 dimethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 700 N-((2S,4S)-2-benzyl-1-((piperidin-3- 487 0.1936 2.1088 ylmethyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 701 5-cyclopropyl-N-((2S,4S)-1-((3,5- 426 0.2103 1.8410 dimethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 702 5-cyclopropyl-N-((1R,3r,5S)-8-((3,4,5- 452 0.2151 1.2352 trimethylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 703 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 510 0.2170 0.8042 (methyl(2- morpholinoethyl)amino)propyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 704 N-((2R,4S)-1-((3-amino-1- 447 0.2181 phenylpropyl)sulfonyl)-2-methylpiperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide 705 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 473 0.2250 1.5149 (phenethylamino)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 706 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 391 0.2376 1.2126 (pyridin-4-ylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 707 N-((2S,4S)-2-benzyl-1-(((1-(3- 545 0.2469 2.5353 hydroxypropyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 708 N-((2S,4S)-1-((6-aminopyridin-2- 406 0.2521 1.6621 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 709 5-cyclopropyl-N-((1R,5R)-9-(N-methyl- 466 0.2575 1.9155 N-(1-methylpiperidin-4-yl)sulfamoyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 710 5-cyclopropyl-N-((3S,4R)-3-methyl-1-((4- 412 0.2607 0.8310 methylpiperazin-1-yl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 711 5-cyclopropyl-N-((2S,4S)-1-(((R)-3-ethyl- 440 0.2725 1.1521 4-methylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 712 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 440 0.2749 1.0984 (((2S,5R)-2,4,5-trimethylpiperazin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 713 5-cyclopropyl-N-((1R,3r,5S)-8-((3-ethyl- 452 0.2934 1.1757 4-methylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 714 N-((2S,4R)-2-benzyl-1-(N-methyl-N- 502 0.2949 3.1527 (piperidin-4-yl)sulfamoyl)piperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 715 N-((2R,4S)-2-benzyl-1-(N-methyl-N- 502 0.2971 3.0425 (piperidin-4-yl)sulfamoyl)piperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 716 N-((2R,4R)-1-((3-amino-4- 461 0.3027 3.5340 phenylbutyl)sulfonyl)-2-methylpiperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide 717 N-((2S,4S)-2-benzyl-1-(pyrrolidin-3- 459 0.3061 2.0240 ylsulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 718 5-cyclopropyl-N-((1R,3s,5S)-9-(N- 466 0.3090 1.6220 methyl-N-(1-methylpiperidin-4- yl)sulfamoyl)-9-azabicyclo[3.3.1]nonan-3- yl)isoxazole-3-carboxamide 719 N-((3S,4R)-1-(N-(1-benzylpiperidin-4-yl)- 516 0.3199 1.2054 N-methylsulfamoyl)-3-methylpiperidin-4- yl)-5-cyclopropylisoxazole-3-carboxamide

720 N-((2S,4S)-2-benzyl-1-(((1-(2- 545 0.3218 2.4270 methoxyethyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 721 5-cyclopropyl-N-((1R,3s,5S)-8- 423 0.3224 1.8253 ((piperidin-3-ylmethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 722 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 486 0.3257 1.5226 phenylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 723 N-((2S,4R)-2-benzyl-1-((piperidin-4- 487 0.3260 2.7313 ylmethyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 724 5-cyclopropyl-N-((1R,3s,5S)-8-(N- 438 0.3330 2.4407 methyl-N-(piperidin-4-yl)sulfamoyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 725 N-((2S,4S)-2-benzyl-1-(piperidin-3- 473 0.3401 3.0662 ylsulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 726 N-((1R,3r,5S)-8-((2-(3- 529 0.3596 2.4667 (benzyloxy)pyrrolidin-1- yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 727 (E)-5-cyclopropyl-N-(1-((3- 369 0.3633 1.3883 (methylamino)prop-1-en-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 728 5-cyclopropyl-N-((2S,4S)-1-(((R)-3- 454 0.3805 1.3655 isopropyl-4-methylpiperazin-1- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 729 5-cyclopropyl-N-((1R,3s,5S)-8-(piperidin- 409 0.4110 2.5264 3-ylsulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 730 N-((1R,3r,5S)-9-((2-aminopyridin-4- 432 0.4128 1.3188 yl)sulfonyl)-9-azabicyclo[3.3.1]nonan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 731 5-cyclopropyl-N-((2S,4R,5S)-2,5- 426 0.4183 1.3321 dimethyl-1-((4-methylpiperazin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 732 5-cyclopropyl-N-((2S,4R,5S)-2,5- 425 0.4313 1.4616 dimethyl-1-((2-(pyrrolidin-1- yl)ethyl)sulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 733 N-((1R,5R)-9-((5-chloropyridin-2- 451 0.4417 1.9585 yl)sulfonyl)-9-azabicyclo[3.3.1]nonan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 734 N-((1R,3r,5S)-9-((2-((3- 489 0.4425 4.1727 aminopropyl)amino)pyridin-3- yl)sulfonyl)-9-azabicyclo[3.3.1]nonan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 735 5-cyclopropyl-N-((2S,4S)-1-(((S)-3,4- 426 0.4458 1.3552 dimethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 736 N-((2S,4S)-1-((3-benzylpiperazin-1- 488 0.4521 2.0254 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 737 N-((2S,4S)-1-((2-benzylpiperazin-1- 488 0.4692 6.9424 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 738 5-cyclopropyl-N-((3S,4R)-3-methyl-1- 524 0.4765 2.8209 (((1-(2-morpholinoethyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 739 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 431 0.4911 2.3968 (pyridin-4-yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 740 N-((1R,3s,5S)-9-((6-aminopyridin-2- 432 0.4976 yl)sulfonyl)-9-azabicyclo[3.3.1]nonan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 741 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((4- 405 0.5123 methylpyridin-2-yl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 742 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 496 0.5129 0.8991 (methyl(2- morpholinoethyl)amino)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 743 5-cyclopropyl-N-((1R,3r,5S)-8-((2-((2- 482 0.5137 1.8184 morpholinoethyl)amino)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 744 N-((2R,4R)-2-benzyl-1-((piperidin-4- 487 0.5179 2.3476 ylmethyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 745 N-((2S,4S)-2-benzyl-1-((pyrrolidin-2- 473 0.5333 2.6361 ylmethyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 746 5-cyclopropyl-N-((2R,4S,5R)-2,5- 425 0.5406 1.6619 dimethyl-1-((2-(pyrrolidin-1- yl)ethyl)sulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 747 5-cyclopropyl-N-((2R,4R)-2-methyl-1-(1- 408 0.5828 2.4138 methyl-1H-benzo[d]imidazole-5- carbonyl)piperidin-4-yl)isoxazole-3- carboxamide 748 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 487 0.5844 3.1758 (methyl(phenethyl)amino)ethyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 749 N-((1R,3r,5S)-8-((3-benzylpiperazin-1- 500 0.5903 3.5562 yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 750 N-((2S,4S)-2-benzyl-1-(((1-(3- 559 0.6247 3.4693 methoxypropyl)piperidin-4- yl)methyl)sulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 751 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 474 0.6332 2.8860 (((R)-3-phenylpiperazin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 752 N-((2R,4R)-2-benzyl-1-(pyrrolidin-3- 459 0.6667 2.4929 ylsulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 753 5-cyclopropyl-N-((1R,3s,5S)-9-((5- 435 0.6723 2.0403 fluoropyridin-3-yl)sulfonyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 754 N-((2S,4S)-1-(N-(2-chloro-6- 471 0.6757 3.7071 fluorobenzyl)sulfamoyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 755 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 440 0.6773 2.3828 (((3S,5R)-3,4,5-trimethylpiperazin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 756 N-((2S,4S)-1-((2-aminopyridin-4- 406 0.6839 1.7689 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 757 N-((2R,4R)-2-benzyl-1-(N-methyl-N- 502 0.7255 7.6085 (piperidin-4-yl)sulfamoyl)piperidin-4-yl)- 5-cyclopropylisoxazole-3-carboxamide 758 N-((1R,3r,5S)-8-((3-oxa-7,9- 452 0.7306 1.6477 diazabicyclo[3.3.1]nonan-7-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 759 5-cyclopropyl-N-((2S,4S)-1-(((R)-3-(2- 456 0.7327 2.0633 hydroxyethyl)-4-methylpiperazin-1- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 760 5-cyclopropyl-N-(1-(4-methylpiperidine- 361 0.7416 4-carbonyl)piperidin-4-yl)isoxazole-3- carboxamide 761 N-((2S,4S)-1-((4- 461 0.7514 2.8538 (acetamidomethyl)phenyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 762 5-cyclopropyl-N-((1R,3r,5S)-8-((2-(2- 467 0.7698 2.0670 (methoxymethyl)pyrrolidin-1- yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 763 5-cyclopropyl-N-((1R,3S)-9-((5- 431 0.7704 methylpyridin-2-yl)sulfonyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 764 5-cyclopropyl-N-((2R,4R)-2-methyl-1-(4- 482 0.8061 9.6655 (2-(piperazin-1- yl)ethoxy)benzoyl)piperidin-4- yl)isoxazole-3-carboxamide 765 5-cyclopropyl-N-((1R,5R)-9-((4- 452 0.8362 2.4208 ethylpiperazin-1-yl)sulfonyl)-9- azabicyclo[3.3.1]nonan-3-yl)isoxazole-3- carboxamide 766 N-((1R,3r,5S)-8-((4-(2-aminopropan-2- (481) yl)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide *IC.sub.50 values are an average of n = 1 to n = 50

TABLE-US-00006 TABLE 3A LCMS SMYD3 SMYD3 M + H Biochem Cell Cpd. or IC.sub.50* IC.sub.50* No. Chemical Name (M + Na) (uM) (uM) 767 5-cyclopropyl-N-((1R,3R,5S)-8-(((1S,4S)- 467.00 0.0004 0.01945 4-((2- hydroxyethyl)amino)cyclohexyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 768 5-cyclopropyl-N-((1R,3R,5S)-8-(((1R,4R)- 467.00 0.00071 0.03468 4-((2- hydroxyethyl)amino)cyclohexyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 769 5-cyclopropyl-N-((1R,3r,5S)-8-((7- 554.00 0.00076 0.01791 phenethyl-2,7-diazaspiro[3.5]nonan-2- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 770 5-cyclopropyl-N-((1R,3r,5S)-8-(((1- 437.00 0.00088 0.01916 methylpiperidin-4-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 771 5-cyclopropyl-N-((1R,3R,5S)-8-(((1s,4S)- 451.00 0.00094 0.02555 4-(dimethylamino)cyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 772 N-((2S,4S)-1-((((1S,3S)-3- 411.00 0.00095 0.03265 aminocyclopentyl)methyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 773 N-((2S,4S)-1-(((1r,4S)-4- 411.00 0.00103 0.01771 aminocyclohexyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 774 N-((2S,4S)-1-((4-amino-4-methylpiperidin- 426.00 0.00104 0.02561 l-yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 775 5-cyclopropyl-N-((2R,4R)-2-ethyl-1-(((1- 439.00 0.00107 0.01437 methylpiperidin-4- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 776 N-((1R,3R,5S)-8-(((1r,4R)-4- 513.00 0.00112 0.02758 (benzylamino)cyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 777 5-cyclopropyl-N-((2R,4R)-1-(((1- 453.00 0.00114 0.01698 methylpiperidin-4-yl)methyl)sulfonyl)-2- propylpiperidin-4-yl)isoxazole-3- carboxamide 778 5-cyclopropyl-N-((1R,3r,5S)-8-(((1-(4- 531.00 0.00118 0.04475 fluorobenzyl)piperidin-4- yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 779 5-ethyl-N-((1R,3r,5S)-8-(((1-(4,4,4- 521.00 0.0012 0.02811 trifluorobutyl)piperidin-4- yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 780 5-cyclopropyl-N-((2S,4S)-1-((4-((2- 470.00 0.00121 0.02389 hydroxyethyl)(methyl)amino)piperidin-1- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 781 5-cyclopropyl-N-((1R,3r,5S)-8-(((1- 465.00 0.00122 0.02703 propylpiperidin-4-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 782 5-cyclopropyl-N-((1R,3r,5S)-8-((7-methyl- 464.00 0.00123 0.03009 2,7-diazaspiro[3.5]nonan-2-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 783 N-((2S,4S)-1-((3- 411.00 0.00124 0.05168 (aminomethyl)cyclopentyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 784 N-((2S,4S)-1-((((1R,3R)-3- 411.00 0.00129 0.03928 aminocyclopentyl)methyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 785 5-cyclopropyl-N-((1R,3r,5S)-8-(((1- 451.00 0.00136 0.04408 ethylpiperidin-4-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 786 5-cyclopropyl-N-((1R,3R,5S)-8-(((1r,4R)- 437.00 0.00137 0.0358 4-(methylamino)cyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 787 5-cyclopropyl-N-((1R,3r,5S)-8-(((1- 465.00 0.00138 0.03859 isopropylpiperidin-4-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 788 5-ethyl-N-((1R,3R,5S)-8-(((1r,4R)-4-((2- 455.00 0.00142 0.03076 hydroxyethyl)amino)cyclohexyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 789 N-((1R,3R,5S)-8-(((1r,4R)-4- 411.00 0.00159 0.03186 aminocyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- ethylisoxazole-3-carboxamide 790 N-((3S,4R)-1-(((1r,4S)-4- 433.00 0.00181 0.056 aminocyclohexyl)sulfonyl)-3- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 791 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 528.00 0.00182 0.0404 (phenethylamino)piperidin-1-yl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 792 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((2- 468.00 0.00185 0.04492 hydroxyethyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 793 N-((2S,4S)-1-((4-aminopiperidin-1- 400.20 0.00185 0.02625 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- ethylisoxazole-3-carboxamide 794 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((4,4,4- 534.00 0.00187 0.03473 trifluorobutyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 795 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((2- 425.00 0.00187 0.02758 ((S)-1-methylpyrrolidin-3- yl)ethyl)sulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 796 N-((1R,3r,5S)-8-((4-amino-4- 438.00 0.0019 0.04067 methylpiperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 797 5-ethyl-N-((1R,3r,5S)-8-(((1- 425.00 0.0019 0.04267 methylpiperidin-4-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 798 5-cyclopropyl-N-((1R,3R,5S)-8-(((1s,4S)- 437.00 0.00191 0.03045 4-(methylamino)cyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 799 N-((1R,3r,5S)-8-((4-aminopiperidin-1- 412.00 0.00205 0.03459 yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)- 5-ethylisoxazole-3-carboxamide 800 N-((2S,4S)-1-((4-amino-3-methylpiperidin- 426.00 0.00218 0.03972 l-yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 801 N-((1R,3r,5S)-8-((6-amino-3- 422.00 0.00219 0.02773 azabicyclo[3.1.0]hexan-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 802 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(((3- 425.00 0.0023 0.02696 (methylamino)cyclopentyl)methyl)sulfonyl) piperidin-4-yl)isoxazole-3-carboxamide 803 N-((1R,3r,5S)-8-((4-amino-2- 438.00 0.00231 0.05897 methylpiperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 804 N-((2S,4S)-1-((1,8-diazaspiro[4.5]decan-8- 452.00 0.00236 0.06082 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 805 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 452.00 0.00239 0.05324 (dimethylamino)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 806 N-((2S,4S)-1-((3-aminopropyl)sulfonyl)-2- 399.00 0.0024 0.11318 propylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 807 5-cyclopropyl-N-((1R,3R,5S)-8-(((1r,4R)- 451.00 0.00244 0.08569 4-(dimethylamino)cyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 808 5-cyclopropyl-N-((2S,4S)-1-((4-((2- 456.00 0.00247 0.03681 hydroxyethyl)amino)piperidin-1- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 809 5-cyclopropyl-N-((1R,3r,5S)-8-(((1- 479.00 0.00249 0.04268 isobutylpiperidin-4-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 810 N-((1R,3r,5S)-8-((4- 514.00 0.00253 0.07225 (benzylamino)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 811 N-((2S,4S)-1-((4-(2-aminopropan-2- 435.00 0.00258 0.03361 yl)phenyl)sulfonyl)-2-methylpiperidin-4- yl)-5-ethylisoxazole-3-carboxamide 812 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 438.00 0.00265 0.04108 (methylamino)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 813 N-((2S,4S)-1-((1,7-diazaspiro[3.5]nonan-7- 438.00 0.00273 0.03566 yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 814 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((2- 425.00 0.00277 0.04417 ((R)-1-methylpyrrolidin-3- yl)ethyl)sulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 815 N-((1R,3R,5S)-8-(((1s,4S)-4- 411.00 0.00278 0.05262 aminocyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- ethylisoxazole-3-carboxamide 816 5-cyclopropyl-N-((1R,3S,5S)-8-(((S)-1-(1- 451.00 0.00291 0.05232 methylpiperidin-4-yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 817 N-((1R,3r,5S)-8-((3,8- 436.00 0.00311 0.0348 diazabicyclo[3.2.1]octan-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 818 5-cyclopropyl-N-((1R,3r,5S)-8-((7- 506.00 0.00313 0.05544 isobutyl-2,7-diazaspiro[3.5]nonan-2- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 819 N-((2S,4S)-1-((((1R,3R)-3- 425.00 0.0032 0.12419 aminocyclohexyl)methyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 820 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((2- 482.00 0.00327 0.05743 hydroxyethyl)(methyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 821 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 494.00 0.00328 0.05852 (isopentylamino)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 822 5-cyclopropyl-N-((1R,3r,5S)-8-((8-ethyl- 464.00 0.00344 0.04374 3,8-diazabicyclo[3.2.1]octan-3-yl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 823 5-cyclopropyl-N-((2S,4S)-1-(((3- 439.00 0.0035 0.06716 (dimethylamino)cyclopentyl)methyl)sulfon yl)-2-memylpiperidin-4-yl)isoxazole-3- carboxamide 824 N-((1R,3r,5S)-8-((7-benzyl-2,7- 540.00 0.00387 0.08042 diazaspiro[3.5]nonan-2-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 825 5-cyclopropyl-N-((1R,3R,5S)-8-(((1r,4R)- 481.00 0.00391 0.05526 4-((2- methoxyemyl)amino)cyclohexyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 826 5-cyclopropyl-N-((1R,3R,5S)-8-(((1s,4S)- 481.00 0.00392 0.0584 4-((2- methoxyethyl)amino)cyclohexyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 827 N-((2S,4S)-1-(((3- 425.00 0.004 0.07273 aminocyclohexyl)methyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 828 N-((2S,4S)-1-((3,6- 410.00 0.00418 0.14958

diazabicyclo[3.1.1]heptan-6-yl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 829 5-cyclopropyl-N-((2S,4S)-1-((4- 440.00 0.0043 0.07016 (ethylamino)piperidin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 830 N-((1R,3r,5S)-8-((4- 438.00 0.00434 1.55122 (aminomethyl)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 831 N-((1R,3r,5S)-8-((4-amino-3- 438.00 0.00436 0.08513 methylpiperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 832 N-((1R,3r,5S)-8-((3,6- 422.00 0.00438 0.13361 diazabicyclo[3.1.1]heptan-6-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 833 5-ethyl-N-((1R,3R,5S)-8-(((1s,4S)-4-((2- 455.00 0.00447 0.07223 hydroxyethyl)amino)cyclohexyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 834 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((3- 496.00 0.00457 0.04872 hydroxypropyl)(methyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 835 N-((1R,3r,5S)-8-((1,8-diazaspiro[4.5]decan- 464.00 0.00463 0.11781 8-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 836 N-((2S,4S)-1-((((1S,3S)-3- 425.00 0.00464 0.08897 aminocyclohexyl)methyl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 837 5-cyclopropyl-N-((3S,4R)-1-(((1r,4S)-4- 439.00 0.00482 0.08441 (dimethylamino)cyclohexyl)sulfonyl)-3- methylpiperidin-4-yl)isoxazole-3- carboxamide 838 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 548.00 0.0049 0.05236 (methyl(4,4,4- trifluorobutyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 839 N-((2S,4S)-1-((4- 516.00 0.00497 0.15413 (benzyl(methyl)amino)piperidin-1- yl)sulfonyl)-2-methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 840 N-((1R,3r,5S)-8-((2,5- 422.00 0.00501 0.05595 diazabicyclo[2.2.1]heptan-2-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 841 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((2- 411.00 0.00505 0.12354 ((S)-pyrrolidin-3- yl)ethyl)sulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 842 5-cyclopropyl-N-((1R,3R,5S)-8-(((R)-1- 437.00 0.0051 0.02901 (piperidin-4-yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 843 5-cyclopropyl-N-((2S,4S)-1-((4- 468.00 0.00511 0.07768 (isobutylamino)piperidin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 844 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 542.00 0.00528 0.30533 (methyl(phenethyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 845 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((3- 482.00 0.0053 0.08635 hydroxypropyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 846 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 508.00 0.00536 0.08024 (isopentyl(methyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 847 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((4- 466.00 0.00553 0.07581 (pyrrolidin-1-yl)piperidin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 848 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((4- 532.00 0.00573 0.15298 fluorobenzyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 849 N-((1R,3r,5S)-8-((1,7- 450.00 0.00595 0.06199 diazaspiro[3.5]nonan-7-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 850 5-cyclopropyl-N-((1R,3r,5S)-8-((8-(3- 494.00 0.00621 0.05877 hydroxypropyl)-3,8- diazabicyclo[3.2.1]octan-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 851 5-cyclopropyl-N-((2S,4S)-1-((4-((2- 484.00 0.00644 0.12457 methoxyethyl)(methyl)amino)piperidin-1- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 852 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 466.00 0.0065 0.1142 (ethyl(methyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 853 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 480.00 0.00655 0.07104 (isobutylamino)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 854 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 411.00 0.00692 ((((S)-piperidin-3- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 855 N-((1R,3r,5S)-8-((2,5- 436.00 0.00706 0.06866 diazabicyclo[2.2.2]octan-2-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 856 5-cyclopropyl-N-((1R,3r,5S)-8-(piperazin- 410.00 0.00709 0.04668 1-ylsulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 857 5-cyclopropyl-N-((1R,3r,5S)-8-(((2,6- 451.00 0.00709 0.12971 dimethylpiperidin-4-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 858 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((2- 411.00 0.0072 0.1723 ((R)-pyrrolidin-3- yl)ethyl)sulfonyl)piperidin-4-yl)isoxazole- 3-carboxamide 859 5-cyclopropyl-N-((1R,3R,5S)-8-(((1r,4R)- 536.00 0.00743 0.20891 4-((2- morpholinoethyl)amino)cyclohexyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole- 3-carboxamide 860 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 494.00 0.00752 0.13926 (isobutyl(methyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 861 5-cyclopropyl-N-((2S,4S)-1-((4-((2- 470.00 0.00765 0.10238 methoxyethyl)amino)piperidin-1- yl)sulfonyl)-2-methylpiperidin-4- yl)isoxazole-3-carboxamide 862 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 480.00 0.00769 0.07647 (methyl(propyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 863 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 466.00 0.00777 0.07998 (propylamino)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 864 5-cyclopropyl-N-((1R,3r,5S)-8-((5-methyl- 436.00 0.00822 0.08622 2,5-diazabicyclo[2.2.1]heptan-2- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 865 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 452.00 0.00855 0.09024 (ethylamino)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 866 5-cyclopropyl-N-((1R,3r,5S)-8-((8- 492.00 0.00863 0.20103 isobutyl-3,8-diazabicyclo[3.2.1]octan-3- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 867 5-cyclopropyl-N-((1R,3r,5S)-8-((8- 540.00 0.00867 0.84417 phenethyl-3,8-diazabicyclo[3.2.1]octan-3- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 868 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((3- 535.00 0.00868 0.31004 (pyrrolidin-1-yl)propyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 869 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((3- 496.00 0.00905 0.11703 methoxypropyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 870 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((2- 482.00 0.00934 0.13021 methoxyethyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 871 N-((1R,3R,5S)-8-(((1r,4R)-4- 425.00 0.00938 0.08674 aminocyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- isopropylisoxazole-3-carboxamide 872 5-cyclopropyl-N-((2S,4S)-1-((4- 468.00 0.00946 0.18336 (diethylamino)piperidin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 873 N-((3S,4R)-1-(((1s,4R)-4- 411.00 0.00962 0.16925 aminocyclohexyl)sulfonyl)-3- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 874 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 549.00 0.00987 0.23671 (methyl(3-(pyrrolidin-1- yl)propyl)amino)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 875 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 411.00 0.01 ((((R)-piperidin-3- yl)methyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 876 5-cyclopropyl-N-((1R,3R,5S)-8-(((R)-1-(1- 451.00 0.01 0.18571 methylpiperidin-4-yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 877 5-cyclopropyl-N-((1R,3S,5S)-8-(N- 438.00 0.01002 0.17551 ((2R,4S)-2-methylpiperidin-4- yl)sulfamoyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 878 N-((1R,3R,5S)-8-(((R)-azepan-3- 423.00 0.01009 0.24072 yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)- 5-cyclopropylisoxazole-3-carboxamide 879 5-isopropyl-N-((1R,3r,5S)-8-(((1- 439.00 0.01066 0.2063 methylpiperidin-4-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 880 N-((1R,3r,5S)-8-((4- 528.00 0.01085 0.45474 (benzyl(methyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)- 5-cyclopropylisoxazole-3-carboxamide 881 5-cyclopropyl-N-((1R,3r,5S)-8-((8-(2- 480.00 0.01091 0.06886 hydroxyethyl)-3,8- diazabicyclo[3.2.1]octan-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 882 5-cyclopropyl-N-((1R,3S,5S)-8-(((S)-1- 437.00 0.01118 0.08563 (piperidin-4-yl)ethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 883 N-((1R,3S,5S)-8-(((S)-azepan-3- 423.00 0.01204 0.12799 yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)- 5-cyclopropylisoxazole-3-carboxamide 884 N-((1R,3S,5S)-8-(N-((2S)-2- 514.00 0.01205 0.2833 benzylpiperidin-4-yl)sulfamoyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 885 5-cyclopropyl-N-((3S,4R)-3-methyl-1- 425.00 0.01209 0.15705 (((1r,4S)-4- (methylamino)cyclohexyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 886 5-cyclopropyl-N-((1R,3S,5S)-8-(N- 438.00 0.01214 0.20549 ((2S,4S)-2-methylpiperidin-4- yl)sulfamoyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 887 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 424.00 0.01223 0.08778 methylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 888 5-cyclopropyl-N-((1R,3r,5S)-8-((8-(3- 508.00 0.01243 0.11756 methoxypropyl)-3,8- diazabicyclo[3.2.1]octan-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 889 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 480.00 0.01269 0.2163 (diethylamino)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 890 N-((2S,4S)-1-((4-amino-2-methylpiperidin- 426.00 0.01316 0.23901 1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5-

cyclopropylisoxazole-3-carboxamide 891 N-((1R,3R,5S)-8-(((1R,5S)-8-amino-3- 472.00 0.01331 0.14515 azabicyclo[3.2.1]octan-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 892 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((4- 582.00 0.01346 0.26828 (trifluoromethyl)benzyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 893 5-cyclopropyl-N-((1R,3r,5S)-8-(N-(1- 438.00 0.01374 0.2392 methylpiperidin-4-yl)sulfamoyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 894 5-cyclopropyl-N-((1R,3R,5S)-8-(((R)-1-(1- 527.00 0.01388 0.27989 methylpiperidin-4-yl)-2- phenylethyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 895 5-cyclopropyl-N-((1R,3r,5S)-8-((5-methyl- 450.00 0.01393 0.18594 2,5-diazabicyclo[2.2.2]octan-2-yl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 896 N-((1R,3R,5S)-8-(((1r,4R)-4-amino-4- 437.00 0.01401 0.08658 methylcyclohexyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 897 5-cyclopropyl-N-((1R,3r,5S)-8-(N- 424.00 0.01414 0.4229 (piperidin-4-yl)sulfamoyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 898 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((4- 516.00 0.01431 0.24039 (((R)-1-phenylethyl)amino)piperidin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 899 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((3- 510.00 0.01448 0.16833 methoxypropyl)(methyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 900 5-cyclopropyl-N-((3S,4R)-3-methyl-1- 425.00 0.01456 0.17732 (((1s,4R)-4- (methylamino)cyclohexyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 901 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 424.00 0.01513 0.09768 methylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 902 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 438.00 0.01524 0.15537 ethylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 903 5-cyclopropyl-N-((2S,4S)-1-(((2,6- 439.00 0.0162 0.27691 dimethylpiperidin-4-yl)methyl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 904 N-((1R,3r,5S)-8-((8-benzyl-3,8- 526.00 0.01688 0.39499 diazabicyclo[3.2.1]octan-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 905 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((4- 516.00 0.01713 0.33103 (((S)-1-phenylethyl)amino)piperidin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 906 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 478.00 0.01715 0.22884 (pyrrolidin-1-yl)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 907 5-cyclopropyl-N-((1R,3r,5S)-8-((2,5- 438.00 0.01774 0.23784 dimethylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 908 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((4- 525.00 0.01843 0.25328 ((2-morpholinoethyl)amino)piperidin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 910 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 397.00 0.01899 0.18648 (((R)-piperidin-3-yl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 911 N-((1R,3r,5S)-8-((4-aminopiperidin-1- 426.00 0.02046 0.14394 yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)- 5-isopropylisoxazole-3-carboxamide 912 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((3- 551.00 0.02093 0.31628 morpholinopropyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 913 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(((S)- 397.00 0.02164 0.25547 piperidin-3-yl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 914 5-cyclopropyl-N-((1R,3r,5S)-8-((8-(4,4,4- 546.00 0.02288 0.29876 trifluorobutyl)-3,8- diazabicyclo[3.2.1]octan-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 915 5-cyclopropyl-N-((1R,3S,5S)-8-(((2S,5S)- 438.00 0.02318 0.23054 2,5-dimethylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 916 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((2- 496.00 0.02331 0.24735 methoxyethyl)(methyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 917 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 535.00 0.02491 0.37899 (methyl(2-(pyrrolidin-1- yl)ethyl)amino)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 918 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((3,3,3- 520.00 0.02504 0.14824 trifluoropropyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 919 5-cyclopropyl-N-((1R,3S,5S)-8-((((S)- 423.00 0.02538 0.24251 piperidin-2-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 920 5-cyclopropyl-N-((1R,3R,5S)-8-(((1s,4S)- 536.00 0.02655 0.49882 4-((2- morpholinoethyl)amino)cyclohexyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole- 3-carboxamide 921 5-cyclopropyl-N-((1R,3r,5S)-8-((2-(3-((2- 496.00 0.02768 0.37264 hydroxyethyl)(methyl)amino)pyrrolidin-1- yl)ethyl)sulfonyl)-8-azabicyclo[3.2.1]octan- 3-yl)isoxazole-3-carboxamide 922 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((2- 521.00 0.02812 0.28224 (pyrrolidin-1-yl)ethyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 923 5-cyclopropyl-N-((1R,3R,5S)-8-((4-(((R)-1- 528.00 0.02856 0.3101 phenylethyl)amino)piperidin-1-yl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 924 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((2,6- 550.00 0.02889 0.66992 difluorobenzyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 925 5-cyclopropyl-N-((1R,3r,5S)-8-((3- 452.00 0.0299 0.33958 isopropylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 926 5-cyclopropyl-N-((1R,3R,5S)-8-(((R)-1- 423.00 0.02997 0.20921 methylpiperidin-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 927 5-cyclopropyl-N-((1R,3S,5S)-8-((4-(((S)-1- 528.00 0.03088 0.40277 phenylethyl)amino)piperidin-1-yl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 928 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 466.00 0.03621 0.51222 (isopropylamino)piperidin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 929 N-((1R,3r,5S)-8-((4- 431.00 0.03679 10 (aminomethyl)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 930 5-cyclopropyl-N-((1R,3S,5S)-8-((((S)- 409.00 0.03706 0.35105 pyrrolidin-2-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 931 N-((1R,3S,5S)-8-((4-((S)-1- 445.00 0.03725 0.52574 aminoethyl)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 932 N-((2S,4S)-1-(((1R,5S,8R)-8-amino-3- 438.00 0.03872 0.35112 azabicyclo[3.2.1]octan-3-yl)sulfonyl)-2- methylpiperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 933 5-cyclopropyl-N-((1R,3r,5S)-8-((3-methyl- 436.00 0.04243 0.09195 3,6-diazabicyclo[3.1.1]heptan-6- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 934 N-((1R,3R,5S)-8-((4-((R)-1- 445.00 0.04244 0.49372 aminoethyl)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 935 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((4- 539.00 0.04297 0.41384 (methyl(2- morpholinoethyl)amino)piperidin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 936 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 565.00 0.0438 0.62258 (methyl(3- morpholinopropyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 937 5-cyclopropyl-N-((2S,4S)-1-(((R)-2- 426.00 0.04387 0.48447 ethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 938 N-((1R,3r,5S)-8-((4-((4- 539.00 0.04409 0.50761 cyanobenzyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)- 5-cyclopropylisoxazole-3-carboxamide 939 5-cyclopropyl-N-((1R,3r,5S)-8-((2- 486.00 0.04469 0.36133 phenylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 940 N-((1R,3r,5S)-8-((2-benzylpiperazin-1- 522.00 0.04752 yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)- 5-cyclopropylisoxazole-3-carboxamide 941 5-cyclopropyl-N-((1R,3r,5S)-8-((2,4,5- 452.00 0.04791 0.34078 trimethylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 942 N-((1R,3R,5S)-8-(N-((2R)-2- 514.00 0.04811 0.65877 benzylpiperidin-4-yl)sulfamoyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 943 5-cyclopropyl-N-((1R,3S,5S)-8-((4-(((S)-1- 546.00 0.04812 0.60158 (4-fluorophenyl)ethyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 944 5-cyclopropyl-N-((1R,3R,5S)-8-((4-(((R)-1- 546.00 0.04886 0.68313 (4-fluorophenyl)ethyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 945 N-((1R,3r,5S)-8-(N-benzyl-N-(piperidin-4- 514.00 0.05056 0.22262 yl)sulfamoyl)-8-azabicyclo[3.2.1]octan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 946 5-cyclopropyl-N-((1R,3r,5S)-8-((4-(((2- 475.00 0.05097 0.33161 hydroxyethyl)amino)methyl)phenyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole- 3-carboxamide 947 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((2- 537.00 0.05228 0.33809 morpholinoethyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 948 N-((1R,3r,5S)-8-(N-(1-benzylpiperidin-4- 514.00 0.05241 0.41071 yl)sulfamoyl)-8-azabicyclo[3.2.1]octan-3- yl)-5-cyclopropylisoxazole-3-carboxamide 949 N-((2S,4S)-2-benzyl-1-(N-(piperidin-4- 488.00 0.05269 1.50943 yl)sulfamoyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 950 5-cyclopropyl-N-((1R,3r,5S)-8-((2,4- 438.00 0.05287 0.38988 dimethylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 951 5-cyclopropyl-N-((1R,3r,5S)-8-(N-methyl- 438.00 0.05415 0.39515 N-(piperidin-3-yl)sulfamoyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 952 5-cyclopropyl-N-((1R,3S,5S)-8-(((S)-1- 423.00 0.05621 0.28051 methylpiperidin-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 953 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 485.00 0.057 0.58531 (pyrrolidin-1-ylmethyl)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 954 5-cyclopropyl-N-((2S,4S)-2-ethyl-1-(((1- 439.00 0.05793 0.58254 methylpiperidin-4- yl)methyl)sulfonyl)piperidin-4-

yl)isoxazole-3-carboxamide 955 5-cyclopropyl-N-((1R,3r,5S)-8-((8-(2- 494.00 0.05921 0.37299 methoxyethyl)-3,8- diazabicyclo[3.2.1]octan-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 956 5-cyclopropyl-N-((1R,3R,5S)-8-((((R)- 409.00 0.05959 0.73276 pyrrolidin-2-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 957 5-cyclopropyl-N-((3S,4R)-1-(((1s,4R)-4- 439.00 0.06899 0.51249 (dimethylamino)cyclohexyl)sulfonyl)-3- methylpiperidin-4-yl)isoxazole-3- carboxamide 958 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 502.00 0.07666 0.4864 (pyrimidin-2-ylamino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 959 N-((1R,3r,5S)-8-((4-(2- 445.00 0.07973 10 aminoethyl)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 960 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 474.00 0.08058 1.35436 (((R)-2-phenylpiperazin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 961 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 534.00 0.08159 0.36388 (methyl(3,3,3- trifluoropropyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 962 5-cyclopropyl-N-((1R,3r,5S)-8-((4-(2- 473.00 0.08176 0.69533 (methylamino)propan-2- yl)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 963 5-cyclopropyl-N-((1R,3r,5S)-8-((2-ethyl-4- 452.00 0.08289 0.68983 methylpiperazin-1-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 964 5-cyclopropyl-N-((1R,3R,5S)-8-((((R)-1- 437.00 0.08296 0.44954 methylpiperidin-2-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 965 N-((1R,3r,5S)-8-(((1-methylpiperidin-4- 439.00 0.08526 1.31267 yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- propylisoxazole-3-carboxamide 966 N-((2S,4S)-2-benzyl-1-(piperazin-1- 474.00 0.08679 1.1965 ylsulfonyl)piperidin-4-yl)-5- cyclopropylisoxazole-3-carboxamide 967 5-cyclopropyl-N-((1R,3r,5S)-8-((8-(2- 549.00 0.08702 0.50309 morpholinoethyl)-3,8- diazabicyclo[3.2.1]octan-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 968 N-((1R,3r,5S)-8-((4-(aminomethyl)-2- 465.00 0.08835 10 chlorophenyl)sulfony1)-8- azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3-carboxamide 969 5-cyclopropyl-N-((1R,3R,5S)-8-((((R)-1- 423.00 0.08856 0.44032 methylpyrrolidin-2-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 970 N-((1R,3r,5S)-8-((4-(2-aminopropan-2- 469.00 0.08926 0.74846 yl)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-5- ethylisoxazole-3-carboxamide 971 5-cyclopropyl-N-((1R,3R,5S)-8-((((R)- 423.00 0.09085 0.46628 piperidin-2-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 972 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((4- 530.00 0.09327 1.27042 ((2-phenylpropan-2-yl)amino)piperidin-1- yl)sulfonyl)piperidin-4-yl)isoxazole-3- carboxamide 973 5-cyclopropyl-N-((1R,3r,5S)-8-((4- 551.00 0.09526 1.01775 (methyl(2- morpholinoethyl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 974 5-cyclopropyl-N-((2S,4S)-1-(((R)-3- 426.00 0.09899 0.80662 ethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 975 5-cyclopropyl-N-((2S,4S)-1-((2- 440.00 0.10112 0.91436 isopropylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 976 5-cyclopropyl-N-((1R,3S,5S)-8-((((S)-1- 437.00 0.10462 0.55489 methylpiperidin-2-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 977 5-cyclopropyl-N-((1R,3r,5S)-8-((3-methyl- 450.00 0.10714 0.74237 3,8-diazabicyclo[3.2.1]octan-8-yl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 978 5-cyclopropyl-N-((1R,3r,5S)-8-((4-((2- 542.00 0.11701 1.32665 phenylpropan-2-yl)amino)piperidin-1- yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 979 5-cyclopropyl-N-((1R,3S,5S)-8-((((S)-1- 423.00 0.11891 0.43627 methylpyrrolidin-2-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 980 5-cyclopropyl-N-((2S,4S)-1-(((S)-2,4- 426.00 0.12021 0.69682 dimethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 981 5-cyclopropyl-N-((1R,3R,5S)-8-(((R)-1-(2- 453.00 0.12658 0.4656 hydroxyethyl)piperidin-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 982 5-cyclopropyl-N-((1R,3r,5S)-8-(((1- 423.00 0.1344 0.81946 methylpyrrolidin-2-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 983 5-cyclopropyl-N-((2S,4S)-1-(((S)-2- 426.00 0.14182 0.93057 ethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 984 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(((S)- 474.00 0.1419 1.84922 2-phenylpiperazin-1-yl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide 985 5-cyclopropyl-N-((1R,3S,5S)-8-(((S)-1-(2- 453.00 0.15471 0.70778 hydroxyethyl)piperidin-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 986 5-cyclopropyl-N-((1R,3r,5S)-8-((4-(((2- 511.00 0.1556 0.80727 methoxyethyl)amino)methyl)phenyl)sulfonyl)- 8-azabicyclo[3.2.1]octan-3- yl)isoxazole-3-carboxamide 987 N-((2S,4R)-1-((4-(2-aminopropan-2- 435.00 0.15781 0.77598 yl)phenyl)sulfonyl)-2-methylpiperidin-4- yl)-5-ethylisoxazole-3-carboxamide 988 5-cyclopropyl-N-((1R,3r,5S)-8-((4-(2- 487.00 0.15808 1.67415 (dimethylamino)propan-2- yl)phenyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 989 5-cyclopropyl-N-((2S,4S)-2-methyl-1- 411.00 0.17527 1.1575 ((piperidin-2-ylmethyl)sulfonyl)piperidin-4- yl)isoxazole-3-carboxamide 990 5-cyclopropyl-N-((1R,3r,5S)-8-((8-(3,3,3- 532.00 0.18371 0.93509 trifluoropropyl)-3,8- diazabicyclo[3.2.1]octan-3-yl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide 991 5-cyclopropyl-N-((2S,4S)-1-(((1- 453.00 0.18696 2.18933 methylpiperidin-4-yl)methyl)sulfonyl)-2- propylpiperidin-4-yl)isoxazole-3- carboxamide 992 5-cyclopropyl-N-((2S,4S)-1-(((2S,5S)-2,5- 426.00 0.18838 1.11838 dimethylpiperazin-1-yl)sulfonyl)-2- methylpiperidin-4-yl)isoxazole-3- carboxamide 993 5-isobutyl-N-((1R,3r,5S)-8-(((1- 453.00 0.20637 2.77149 methylpiperidin-4-yl)methyl)sulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)isoxazole-3- carboxamide *IC.sub.50 values are an average of n = 1 to n = 50

In another embodiment, a Compound of the Disclosure is a compound having Formulae I-X, provided that the compound is not:

TABLE-US-00007 Structure Name ##STR01035## 5-cyclopropyl-N-(piperidin-4- yl)isoxazole-3-carboxamide ##STR01036## N-(8-azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01037## N-(1-(2-amino-2- oxoethyl)piperidin-4-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01038## 5-cyclopropyl-N-(1- (methylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide ##STR01039## N-(1-benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01040## 5-cyclopropyl-N-(1- isobutyrylpiperidin-4-yl)isoxazole-3- carboxamide ##STR01041## N-(1-benzoylpiperidin-4-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01042## ethyl 4-(5-cyclopropylisoxazole-3- carboxamido)piperidine-1- carboxylate ##STR01043## 5-cyclopropyl-N-(1-(furan-3- carbonyl)piperidin-4-yl)isoxazole-3- carboxamide ##STR01044## 5-cyclopropyl-N-(1-((4- methoxyphenyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide ##STR01045## 5-cyclopropyl-N-(1-tosylpiperidin- 4-yl)isoxazole-3-carboxamide ##STR01046## 5-cyclopropyl-N-(1-(2,6- dimethylpyrimidin-4-yl)piperidin-4- yl)isoxazole-3-carboxamide ##STR01047## N-(1-((4- acetamidophenyl)sulfonyl)piperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide ##STR01048## 5-cyclopropyl-N-(1-(4-isopropyl-5- (pyridin-4-yl)pyrimidin-2- yl)piperidin-4-yl)isoxazole-3- carboxamide ##STR01049## N-(1-7,8-dihydro-5H-pyrano[4,3- d]pyrimidin-2-yl)piperidin-4-yl)-5- ethylisoxazole-3-carboxamide ##STR01050## 5-ethyl-N-(1-(4-isopropyl-5- (pyridin-4-yl)pyrimidin-2- yl)piperidin-4-yl)isoxazole-3- carboxamide

In some embodiments, the disclosure relates to pharmaceutical compositions comprising one or more of the following compounds:

TABLE-US-00008 Structure Name ##STR01051## 5-cyclopropyl-N-(piperidin-4- yl)isoxazole-3-carboxamide ##STR01052## N-(8-azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01053## N-(1-(2-amino-2- oxoethyl)piperidin-4-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01054## 5-cyclopropyl-N-(1- (methylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide ##STR01055## N-(1-benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01056## 5-cyclopropyl-N-(1- isobutyrylpiperidin-4-yl)isoxazole-3- carboxamide ##STR01057## N-(1-benzoylpiperidin-4-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01058## ethyl 4-(5-cyclopropylisoxazole-3- carboxamido)piperidine-1- carboxylate ##STR01059## 5-cyclopropyl-N-(1-(furan-3- carbonyl)piperidin-4-yl)isoxazole-3- carboxamide ##STR01060## 5-cyclopropyl-N-(1-((4- methoxyphenyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide ##STR01061## 5-cyclopropyl-N-(1-tosylpiperidin- 4-yl)isoxazole-3-carboxamide ##STR01062## 5-cyclopropyl-N-(1-(2,6- dimethylpyrimidin-4-yl)piperidin-4- yl)isoxazole-3-carboxamide ##STR01063## N-(1-((4- acetamidophenyl)sulfonyl)piperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide ##STR01064## 5-cyclopropyl-N-(1-(4-isopropyl-5- (pyridin-4-yl)pyrimidin-2- yl)piperidin-4-yl)isoxazole-3- carboxamide ##STR01065## N-(1-7,8-dihydro-5H-pyrano[4,3- d]pyrimidin-2-yl)piperidin-4-yl)-5- ethylisoxazole-3-carboxamide ##STR01066## 5-ethyl-N-(1-(4-isopropyl-5- (pyridin-4-yl)pyrimidin-2- yl)piperidin-4-yl)isoxazole-3- carboxamide

and a pharmaceutically acceptable carrier.

In some embodiments, the disclosure relates to a method of inhibiting SMYD proteins, such as SMYD3 or SMYD2, or both, in a subject, comprising administering to a subject in need thereof an effective amount of at least one of the following compounds:

TABLE-US-00009 Structure Name ##STR01067## 5-cyclopropyl-N-(piperidin-4- yl)isoxazole-3-carboxamide ##STR01068## N-(8-azabicyclo[3.2.1]octan-3-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01069## N-(1-(2-amino-2- oxoethyl)piperidin-4-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01070## 5-cyclopropyl-N-(1- (methylsulfonyl)piperidin-4- yl)isoxazole-3-carboxamide ##STR01071## N-(1-benzylpiperidin-4-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01072## 5-cyclopropyl-N-(1- isobutyrylpiperidin-4-yl)isoxazole-3- carboxamide ##STR01073## N-(1-benzoylpiperidin-4-yl)-5- cyclopropylisoxazole-3- carboxamide ##STR01074## ethyl 4-(5-cyclopropylisoxazole-3- carboxamido)piperidine-1- carboxylate ##STR01075## 5-cyclopropyl-N-(1-(furan-3- carbonyl)piperidin-4-yl)isoxazole-3- carboxamide ##STR01076## 5-cyclopropyl-N-(1-((4- methoxyphenyl)sulfonyl)piperidin- 4-yl)isoxazole-3-carboxamide ##STR01077## 5-cyclopropyl-N-(1-tosylpiperidin- 4-yl)isoxazole-3-carboxamide ##STR01078## 5-cyclopropyl-N-(1-(2,6- dimethylpyrimidin-4-yl)piperidin-4- yl)isoxazole-3-carboxamide ##STR01079## N-(1-((4- acetamidophenyl)sulfonyl)piperidin- 4-yl)-5-cyclopropylisoxazole-3- carboxamide ##STR01080## 5-cyclopropyl-N-(1-(4-isopropyl-5- (pyridin-4-yl)pyrimidin-2- yl)piperidin-4-yl)isoxazole-3- carboxamide ##STR01081## N-(1-7,8-dihydro-5H-pyrano[4,3- d]pyrimidin-2-yl)piperidin-4-yl)-5- ethylisoxazole-3-carboxamide ##STR01082## 5-ethyl-N-(1-(4-isopropyl-5- (pyridin-4-yl)pyrimidin-2- yl)piperidin-4-yl)isoxazole-3- carboxamide

Definitions

For the purpose of the present disclosure, the term "alkyl" as used by itself or as part of another group refers to a straight- or branched-chain aliphatic hydrocarbon containing one to twelve carbon atoms (i.e., C.sub.1-12 alkyl) or the number of carbon atoms designated (i.e., a C.sub.1 alkyl such as methyl, a C.sub.2 alkyl such as ethyl, a C.sub.3 alkyl such as propyl or isopropyl, etc.). In one embodiment, the alkyl group is chosen from a straight chain C.sub.1-10 alkyl group. In another embodiment, the alkyl group is chosen from a branched chain C.sub.3-10 alkyl group. In another embodiment, the alkyl group is chosen from a straight chain C.sub.1-6 alkyl group. In another embodiment, the alkyl group is chosen from a branched chain C.sub.3-6 alkyl group. In another embodiment, the alkyl group is chosen from a straight chain C.sub.1-4 alkyl group. In another embodiment, the alkyl group is chosen from a branched chain C.sub.3-4 alkyl group. In another embodiment, the alkyl group is chosen from a straight or branched chain C.sub.3-4 alkyl group. In another embodiment, the alkyl group is partially or completely deuterated, i.e., one or more hydrogen atoms of the alkyl group are replaced with deuterium atoms. Non-limiting exemplary C.sub.1-10 alkyl groups include methyl (including --CD.sub.3), ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, iso-butyl, 3-pentyl, hexyl, heptyl, octyl, nonyl, and decyl. Non-limiting exemplary C.sub.1-4 alkyl groups include methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, and iso-butyl. Non-limiting exemplary C.sub.1-4 groups include methyl, ethyl, propyl, isopropyl, and tert-butyl.

For the purpose of the present disclosure, the term "optionally substituted alkyl" as used by itself or as part of another group means that the alkyl as defined above is either unsubstituted or substituted with one, two, or three substituents independently chosen from nitro, haloalkoxy, aryloxy, aralkyloxy, alkylthio, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, alkoxycarbonyl, and carboxyalkyl. In one embodiment, the alkyl is a C.sub.1-4 alkyl. In one embodiment, the optionally substituted alkyl is substituted with two substituents. In another embodiment, the optionally substituted alkyl is substituted with one substituent. Non-limiting exemplary optionally substituted alkyl groups include --CH.sub.2CH.sub.2NO.sub.2, --CH.sub.2CH.sub.2CO.sub.2H, --CH.sub.2CH.sub.2SO.sub.2CH.sub.3, --CH.sub.2CH.sub.2COPh, and --CH.sub.2C.sub.6H.sub.11.

For the purpose of the present disclosure, the term "cycloalkyl" as used by itself or as part of another group refers to saturated and partially unsaturated (containing one or two double bonds) cyclic aliphatic hydrocarbons containing one to three rings having from three to twelve carbon atoms (i.e., C.sub.3-12 cycloalkyl) or the number of carbons designated. In one embodiment, the cycloalkyl group has two rings. In one embodiment, the cycloalkyl group has one ring. In another embodiment, the cycloalkyl group is chosen from a C.sub.3-8 cycloalkyl group. In another embodiment, the cycloalkyl group is chosen from a C.sub.3-6 cycloalkyl group. Non-limiting exemplary cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, norbornyl, decalin, adamantyl, cyclohexenyl, and spiro[3.3]heptane.

For the purpose of the present disclosure, the term "optionally substituted cycloalkyl" as used by itself or as part of another group means that the cycloalkyl as defined above is either unsubstituted or substituted with one, two, or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, aralkylamino, heteroalkyl, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkylamino, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, or (heteroaryl)alkyl. In one embodiment, the optionally substituted cycloalkyl is substituted with one, two, or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, or (heteroaryl)alkyl. In one embodiment, the optionally substituted cycloalkyl is substituted with two substituents. In another embodiment, the optionally substituted cycloalkyl is substituted with one substituent. In one embodiment, the optionally substituted cycloalkyl is substituted with at least one amino, alkylamino, or dialkylamino group. The term "amino-substituted cycloalkyl" as used by itself or as part of another group means that the optionally substituted cycloalkyl as defined above is substituted with at least one amino group. In one embodiment, the amino-substituted cycloalkyl is an amino-substituted cyclohexyl group. Non-limiting exemplary optionally substituted cycloalkyl groups include:

##STR01083##

For the purpose of the present disclosure, the term "cycloalkenyl" as used by itself or part of another group refers to a partially unsaturated cycloalkyl group as defined above. In one embodiment, the cycloalkenyl has one carbon-to-carbon double bond. In another embodiment, the cycloalkenyl group is chosen from a C.sub.4-8 cycloalkenyl group. Exemplary cycloalkenyl groups include cyclopentenyl and cyclohexenyl.

For the purpose of the present disclosure, the term "optionally substituted cycloalkenyl" as used by itself or as part of another group means that the cycloalkenyl as defined above is either unsubstituted or substituted with one, two, or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, aralkylamino, heteroalkyl, haloalkyl, monohydroxyalkyl, dihydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. In one embodiment, the optionally substituted cycloalkenyl is substituted with one, two, or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, monohydroxyalkyl, dihydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. In one embodiment, the optionally substituted cycloalkenyl is substituted with two substituents. In another embodiment, the optionally substituted cycloalkenyl is substituted with one substituent. In another embodiment, the cycloalkenyl is unsubstituted.

For the purpose of the present disclosure, the term "alkenyl" as used by itself or as part of another group refers to an alkyl group as defined above containing one, two or three carbon-to-carbon double bonds. In one embodiment, the alkenyl group is chosen from a C.sub.2-6 alkenyl group. In another embodiment, the alkenyl group is chosen from a C.sub.2-4 alkenyl group. Non-limiting exemplary alkenyl groups include ethenyl, propenyl, isopropenyl, butenyl, sec-butenyl, pentenyl, and hexenyl.

For the purpose of the present disclosure, the term "optionally substituted alkenyl" as used herein by itself or as part of another group means the alkenyl as defined above is either unsubstituted or substituted with one, two or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclo.

For the purpose of the present disclosure, the term "alkynyl" as used by itself or as part of another group refers to an alkyl group as defined above containing one to three carbon-to-carbon triple bonds. In one embodiment, the alkynyl has one carbon-to-carbon triple bond. In one embodiment, the alkynyl group is chosen from a C.sub.2-6 alkynyl group. In another embodiment, the alkynyl group is chosen from a C.sub.2-4 alkynyl group. Non-limiting exemplary alkynyl groups include ethynyl, propynyl, butynyl, 2-butynyl, pentynyl, and hexynyl groups.

For the purpose of the present disclosure, the term "optionally substituted alkynyl" as used herein by itself or as part of another group means the alkynyl as defined above is either unsubstituted or substituted with one, two or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclo.

For the purpose of the present disclosure, the term "haloalkyl" as used by itself or as part of another group refers to an alkyl group substituted by one or more fluorine, chlorine, bromine and/or iodine atoms. In one embodiment, the alkyl group is substituted by one, two, or three fluorine and/or chlorine atoms. In another embodiment, the haloalkyl group is chosen from a C.sub.1-4 haloalkyl group. Non-limiting exemplary haloalkyl groups include fluoromethyl, difluoromethyl, trifluoromethyl, pentafluoroethyl, 1,1-difluoroethyl, 2,2-difluoroethyl, 2,2,2-trifluoroethyl, 3,3,3-trifluoropropyl, 4,4,4-trifluorobutyl, and trichloromethyl groups.

For the purpose of the present disclosure, the term "fluoroalkyl" as used by itself or as part of another group refers to an alkyl group substituted by one or more fluorine atoms. In one embodiment, the alkyl group is substituted by one, two, or three fluorine atoms. In another embodiment, the fluoroalkyl group is chosen from a C.sub.1-4 fluoroalkyl group. Non-limiting exemplary fluoroalkyl groups include fluoromethyl, difluoromethyl, trifluoromethyl, pentafluoroethyl, 1,1-difluoroethyl, 2,2-difluoroethyl, 2,2,2-trifluoroethyl, 3,3,3-trifluoropropyl, and 4,4,4-trifluorobutyl.

For the purpose of the present disclosure, the term "hydroxyalkyl" as used by itself or as part of another group refers to an alkyl group substituted with one or more, e.g., one, two, or three, hydroxy groups. In one embodiment, the hydroxyalkyl group is a monohydroxyalkyl group, i.e., substituted with one hydroxy group. In another embodiment, the hydroxyalkyl group is a dihydroxyalkyl group, i.e., substituted with two hydroxy groups. In another embodiment, the hydroxyalkyl group is chosen from a C.sub.1-4 hydroxyalkyl group. Non-limiting exemplary hydroxyalkyl groups include hydroxymethyl, hydroxyethyl, hydroxypropyl and hydroxybutyl groups, such as 1-hydroxyethyl, 2-hydroxyethyl, 1,2-dihydroxyethyl, 2-hydroxypropyl, 3-hydroxypropyl, 3-hydroxybutyl, 4-hydroxybutyl, 2-hydroxy-1-methylpropyl, and 1,3-dihydroxyprop-2-yl.

For the purpose of the present disclosure, the term "alkoxy" as used by itself or as part of another group refers to an optionally substituted alkyl, optionally substituted cycloalkyl, optionally substituted alkenyl or optionally substituted alkynyl attached to a terminal oxygen atom. In one embodiment, the alkoxy group is chosen from a C.sub.1-4 alkoxy group. In another embodiment, the alkoxy group is chosen from a C.sub.1-4 alkyl attached to a terminal oxygen atom, e.g., methoxy, ethoxy, and tert-butoxy.

For the purpose of the present disclosure, the term "alkylthio" as used by itself or as part of another group refers to a sulfur atom substituted by an optionally substituted alkyl group. In one embodiment, the alkylthio group is chosen from a C.sub.1-4 alkylthio group. Non-limiting exemplary alkylthio groups include --SCH.sub.3, and --SCH.sub.2CH.sub.3.

For the purpose of the present disclosure, the term "alkoxyalkyl" as used by itself or as part of another group refers to an alkyl group substituted with an alkoxy group. Non-limiting exemplary alkoxyalkyl groups include methoxymethyl, methoxyethyl, methoxypropyl, methoxybutyl, ethoxymethyl, ethoxyethyl, ethoxypropyl, ethoxybutyl, propoxymethyl, iso-propoxymethyl, propoxyethyl, propoxypropyl, butoxymethyl, tert-butoxymethyl, isobutoxymethyl, sec-butoxymethyl, and pentyloxymethyl.

For the purpose of the present disclosure, the term "haloalkoxy" as used by itself or as part of another group refers to a haloalkyl attached to a terminal oxygen atom. Non-limiting exemplary haloalkoxy groups include fluoromethoxy, difluoromethoxy, trifluoromethoxy, and 2,2,2-trifluoroethoxy.

For the purpose of the present disclosure, the term "heteroalkyl" as used by itself or part of another group refers to a stable straight or branched chain hydrocarbon radical containing 1 to 10 carbon atoms and at least two heteroatoms, which can be the same or different, selected from O, N, or S, wherein: 1) the nitrogen atom(s) and sulfur atom(s) can optionally be oxidized; and/or 2) the nitrogen atom(s) can optionally be quaternized. The heteroatoms can be placed at any interior position of the heteroalkyl group or at a position at which the heteroalkyl group is attached to the remainder of the molecule.

In one embodiment, the heteroalkyl group contains two oxygen atoms. In one embodiment, the heteroalkyl contains one oxygen and one nitrogen atom. In one embodiment, the heteroalkyl contains two nitrogen atoms. Non-limiting exemplary heteroalkyl groups include --CH.sub.2OCH.sub.2CH.sub.2OCH.sub.3, --OCH.sub.2CH.sub.2OCH.sub.2CH.sub.2OCH.sub.3, --CH.sub.2NHCH.sub.2CH.sub.2OCH.sub.2, --OCH.sub.2CH.sub.2NH.sub.2, --NHCH.sub.2CH.sub.2N(H)CH.sub.3, --CH.sub.2CH.sub.2CH.sub.2N(H)CH.sub.2CH.sub.2NH.sub.2, --CH.sub.2CH.sub.2CH.sub.2N(H)CH.sub.2CH.sub.2N(H)CH.sub.3, --NHCH.sub.2CH.sub.2OCH.sub.3, --N(CH.sub.3)CH.sub.2CH.sub.2CH.sub.2OCH.sub.3, and --OCH.sub.2CH.sub.2OCH.sub.3.

For the purpose of the present disclosure, the term "aryl" as used by itself or as part of another group refers to a monocyclic or bicyclic aromatic ring system having from six to fourteen carbon atoms (i.e., C.sub.6-14 aryl). Non-limiting exemplary aryl groups include phenyl (abbreviated as "Ph"), naphthyl, phenanthryl, anthracyl, indenyl, azulenyl, biphenyl, biphenylenyl, and fluorenyl groups. In one embodiment, the aryl group is chosen from phenyl or naphthyl. In one embodiment, the aryl group is phenyl.

For the purpose of the present disclosure, the term "optionally substituted aryl" as used herein by itself or as part of another group means that the aryl as defined above is either unsubstituted or substituted with one to five substituents independently selected from the group consisting of halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, aralkylamino, heteroalkyl, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, heteroaryloxy, aralkyl, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, (cycloalkylamino)alkyl, (C.sub.1-4 haloalkoxy)alkyl, (heteroaryl)alkyl, --N(R.sup.43)(R.sup.44), and --N(H)C(.dbd.O)--R.sup.45, wherein R.sup.43 is hydrogen or C.sub.1-4 alkyl; R.sup.44 is alkoxyalkyl, (heterocyclo)alkyl, (amino)alkyl, (alkylamino)alkyl, or (dialkylamino)alkyl; and R.sup.45 is alkyl, optionally substituted aryl or optionally substituted heteroaryl. In one embodiment, the optionally substituted aryl is substituted with one to five substituents independently selected from the group consisting of halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, heteroaryloxy, aralkyl, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mereaptoalkyl, (heterocyclo)alkyl, (cycloalkylamino)alkyl, (C.sub.1-4 haloalkoxy)alkyl, (heteroaryl)alkyl, --N(R.sup.43)(R.sup.44), and --N(H)C(.dbd.O)--R.sup.45. In one embodiment, the optionally substituted aryl is an optionally substituted phenyl. In one embodiment, the optionally substituted phenyl has four substituents. In another embodiment, the optionally substituted phenyl has three substituents. In another embodiment, the optionally substituted phenyl has two substituents. In another embodiment, the optionally substituted phenyl has one substituent. In another embodiment, the optionally substituted phenyl has at least one amino, alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl, or (dialkylamino)alkyl substituent. The term "(amino)alkyl-substituted phenyl" as used by itself or as part of another group means that the optionally substituted phenyl as defined above is substituted with at least one (amino)alkyl group. Non-limiting exemplary substituted aryl groups include 2-methylphenyl, 2-methoxyphenyl, 2-fluorophenyl, 2-chlorophenyl, 2-bromophenyl, 3-methylphenyl, 3-methoxyphenyl, 3-fluorophenyl, 3-chlorophenyl, 4-methylphenyl, 4-ethylphenyl, 4-methoxyphenyl, 4-fluorophenyl, 4-chlorophenyl, 2,6-di-fluorophenyl, 2,6-di-chlorophenyl, 2-methyl, 3-methoxyphenyl, 2-ethyl, 3-methoxyphenyl, 3,4-di-methoxyphenyl, 3,5-di-fluorophenyl 3,5-di-methylphenyl, 3,5-dimethoxy, 4-methylphenyl, 2-fluoro-3-chlorophenyl, 3-chloro-4-fluorophenyl, 2-phenylpropan-2-amine,

##STR01084## The term optionally substituted aryl is meant to include groups having fused optionally substituted cycloalkyl and fused optionally substituted heterocyclo rings. Examples include:

##STR01085##

For the purpose of the present disclosure, the term "aryloxy" as used by itself or as part of another group refers to an optionally substituted aryl attached to a terminal oxygen atom. A non-limiting exemplary aryloxy group is PhO--.

For the purpose of the present disclosure, the term "heteroaryloxy" as used by itself or as part of another group refers to an optionally substituted heteroaryl attached to a terminal oxygen atom.

For the purpose of the present disclosure, the term "aralkyloxy" or "arylalkyloxy" as used by itself or as part of another group refers to an aralkyl group attached to a terminal oxygen atom. A non-limiting exemplary aralkyloxy group is PhCH.sub.2O--.

For the purpose of the present disclosure, the term "heteroaryl" or "heteroaromatic" refers to monocyclic and bicyclic aromatic ring systems having 5 to 14 ring atoms (i.e., a 5- to 14-membered heteroaryl) and 1, 2, 3, or 4 heteroatoms independently chosen from oxygen, nitrogen or sulfur. In one embodiment, the heteroaryl has three heteroatoms. In another embodiment, the heteroaryl has two heteroatoms. In another embodiment, the heteroaryl has one heteroatom. In another embodiment, the heteroaryl is a 5- to 10-membered heteroaryl. In another embodiment, the heteroaryl has 5 ring atoms, e.g., thienyl, a 5-membered heteroaryl having four carbon atoms and one sulfur atom. In another embodiment, the heteroaryl has 6 ring atoms, e.g., pyridyl, a 6-membered heteroaryl having five carbon atoms and one nitrogen atom. Non-limiting exemplary heteroaryl groups include thienyl, benzo[b]thienyl, naphtho[2,3-b]thienyl, thianthrenyl, furyl, benzofuryl, pyranyl, isobenzofuranyl, benzooxazonyl, chromenyl, xanthenyl, 2H-pyrrolyl, pyrrolyl, imidazolyl, pyrazolyl, pyridyl, pyrazinyl, pyrimidinyl, pyridazinyl, isoindolyl, 3H-indolyl, indolyl, indazolyl, purinyl, isoquinolyl, quinolyl, phthalazinyl, naphthyridinyl, cinnolinyl, quinazolinyl, pteridinyl, 4aH-carbazolyl, carbazolyl, .beta.-carbolinyl, phenanthridinyl, acridinyl, pyrimidinyl, phenanthrolinyl, phenazinyl, thiazolyl, isothiazolyl, phenothiazolyl, isoxazolyl, furazanyl, and phenoxazinyl. In one embodiment, the heteroaryl is chosen from thienyl (e.g., thien-2-yl and thien-3-yl), furyl (e.g., 2-furyl and 3-furyl), pyrrolyl (e.g., 1H-pyrrol-2-yl and 1H-pyrrol-3-yl), imidazolyl (e.g., 2H-imidazol-2-yl and 2H-imidazol-4-yl), pyrazolyl (e.g., 1H-pyrazol-3-yl, 1H-pyrazol-4-yl, and 1H-pyrazol-5-yl), pyridyl (e.g., pyridin-2-yl, pyridin-3-yl, and pyridin-4-yl), pyrimidinyl (e.g., pyrimidin-2-yl, pyrimidin-4-yl, and pyrimidin-5-yl), thiazolyl (e.g., thiazol-2-yl, thiazol-4-yl, and thiazol-5-yl), isothiazolyl (e.g., isothiazol-3-yl, isothiazol-4-yl, and isothiazol-5-yl), oxazolyl (e.g., oxazol-2-yl, oxazol-4-yl, and oxazol-5-yl) and isoxazolyl (e.g., isoxazol-3-yl, isoxazol-4-yl, and isoxazol-5-yl). The term "heteroaryl" is also meant to include possible N-oxides. Exemplary N-oxides include pyridyl N-oxide.

For the purpose of the present disclosure, the term "optionally substituted heteroaryl" as used by itself or as part of another group means that the heteroaryl as defined above is either unsubstituted or substituted with one to four substituents, e.g., one or two substituents, independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, aralkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aralkyl, aryloxy, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, (heteroaryl)alkyl, --N(R.sup.43)(R.sup.44), or --N(H)C(.dbd.O)--R.sup.45, wherein R.sup.43 is hydrogen or C.sub.1-4 alkyl; R.sup.44 is alkoxyalkyl, (heterocyclo)alkyl, (amino)alkyl, (alkylamino)alkyl, or (dialkylamino)alkyl; and R.sup.45 is alkyl, optionally substituted aryl, or optionally substituted heteroaryl. In another embodiment, the optionally substituted heteroaryl is substituted with one to four substituents, e.g., one or two substituents, independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aralkyl, aryloxy, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, (heteroaryl)alkyl, --N(R.sup.43)(R.sup.44), or --N(H)C(.dbd.O)--R.sup.45. In one embodiment, the optionally substituted heteroaryl has one substituent. In one embodiment, the substituent is amino, alkylamino, dialkylamino, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, --N(R.sup.43)(R.sup.44), or --N(H)C(.dbd.O)--R.sup.45. In one embodiment, the optionally substituted is an optionally substituted pyridyl, i.e., 2-, 3-, or 4-pyridyl. Any available carbon or nitrogen atom can be substituted.

For the purpose of the present disclosure, the term "heterocycle" or "heterocyclo" as used by itself or as part of another group refers to saturated and partially unsaturated (e.g., containing one or two double bonds) cyclic groups containing one, two, or three rings having from three to fourteen ring members (i.e., a 3- to 14-membered heterocyclo) and at least one heteroatom. Each heteroatom is independently selected from the group consisting of oxygen, sulfur, including sulfoxide and sulfone, and/or nitrogen atoms, which can be quaternized. The term "heterocyclo" is meant to include cyclic ureido groups such as imidazolidinyl-2-one, cyclic amide groups such as .beta.-lactam, .gamma.-lactam, .delta.-lactam and .epsilon.-lactam, and cyclic carbamate groups such as oxazolidinyl-2-one. The term "heterocyclo" is also meant to include groups having fused optionally substituted aryl groups, e.g., indolinyl, indolinyl-2-one, benzo[d]oxazolyl-2(3H)-one. In one embodiment, the heterocyclo group is chosen from a 4-, 5-, 6-, 7- or 8-membered cyclic group containing one ring and one or two oxygen and/or nitrogen atoms. In one embodiment, the heterocyclo group is chosen from a 5- or 6-membered cyclic group containing one ring and one or two nitrogen atoms. In one embodiment, the heterocyclo group is chosen from a 8-, 9-, 10-, 11-, or 12-membered cyclic group containing two rings and one or two nitrogen atoms. The heterocyclo can be optionally linked to the rest of the molecule through a carbon or nitrogen atom. Non-limiting exemplary heterocyclo groups include 2-oxopyrrolidin-3-yl, 2-imidazolidinone, piperidinyl, morpholinyl, piperazinyl, pyrrolidinyl, 8-azabicyclo[3.2.1]octane (nortropane), 6-azaspiro[2.5]octane, 6-azaspiro[3.4]octane, indolinyl, indolinyl-2-one, 1,3-dihydro-2H-benzo[d]imidazol-2-one.

For the purpose of the present disclosure, the term "optionally substituted heterocyclo" as used herein by itself or part of another group means the heterocyclo as defined above is either unsubstituted or substituted with one to four substituents independently selected from the group consisting of halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, aralkylamino, heteroalkyl, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkylamino, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. Substitution may occur on any available carbon or nitrogen atom, and may form a spirocycle. In another embodiment, the optionally substituted heterocyclo is substituted with one to four substituents independently selected from the group consisting of halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, aralkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. In one embodiment, the optionally substituted heterocyclo is substituted with at least one amino, alkylamino, or dialkylamino group. The term "amino-substituted heterocyclo" as used by itself or as part of another group means that the optionally substituted heterocyclo as defined above is substituted with at least one amino group. Likewise, the term "alkylamino-substituted heterocyclo" as used by itself or as part of another group means that the optionally substituted heterocyclo as defined above is substituted with at least one alkylamino group. In one embodiment, the amino-substituted or alkylamino-substituted heterocyclo is an amino-substituted or alkylamino-substituted piperidine. Non-limiting exemplary optionally substituted heterocyclo groups include:

##STR01086## ##STR01087##

For the purpose of the present disclosure, the term "amino" as used by itself or as part of another group refers to --NH.sub.2.

For the purpose of the present disclosure, the term "alkylamino" as used by itself or as part of another group refers to --NHR.sup.22, wherein R.sup.22 is C.sub.1-6 alkyl. In one embodiment, R.sup.22 is C.sub.1-4 alkyl. Non-limiting exemplary alkylamino groups include --N(H)CH.sub.3 and --N(H)CH.sub.2CH.sub.3.

For the purpose of the present disclosure, the term "dialkylamino" as used by itself or as part of another group refers to --NR.sup.23aR.sup.23b, wherein R.sup.23a and R.sup.23b are each independently C.sub.1-6 alkyl. In one embodiment, R.sup.23a and R.sup.23b are each independently C.sub.1-4 alkyl. Non-limiting exemplary dialkylamino groups include --N(CH.sub.3).sub.2 and --N(CH.sub.3)CH.sub.2CH(CH.sub.3).sub.2.

For the purpose of the present disclosure, the term "hydroxyalkylamino" as used by itself or as part of another group refers to --NHR.sup.24, wherein R.sup.24 is hydroxyalkyl.

For the purpose of the present disclosure, the term "cycloalkylamino" as used by itself or as part of another group refers to --NR.sup.25aR.sup.25b wherein R.sup.25a is optionally substituted cycloalkyl and R.sup.25b is hydrogen or C.sub.1-4 alkyl.

For the purpose of the present disclosure, the term "aralkylamino" as used by itself or as part of another group refers to --NR.sup.26aR.sup.26b, wherein R.sup.26a is aralkyl and R.sup.26b is hydrogen or C.sub.1-4 alkyl. Non-limiting exemplary aralkylamino groups include --N(H)CH.sub.2Ph, --N(H)CHPh.sub.2, and --N(CH.sub.3)CH.sub.2Ph.

For the purpose of the present disclosure, the term "(cycloalkyl)alkylamino" as used by itself or as part of another group refers to --NR.sup.26cR.sup.26d wherein R.sup.26a is (cycloalkyl)alkyl and R.sup.26d is hydrogen or C.sub.1-4 alkyl. Non-limiting exemplary (cycloalkyl)alkylamino groups include:

##STR01088##

For the purpose of the present disclosure, the term "(heterocyclo)alkylamino" as used by itself or as part of another group refers to --NR.sup.26eR.sup.26f, wherein R.sup.26e is (heterocyclo)alkyl and R.sup.26f is hydrogen or C.sub.1-4 alkyl. Non-limiting exemplary (heterocyclo)alkylamino groups include:

##STR01089##

For the purpose of the present disclosure, the term "(amino)alkyl" as used by itself or as part of another group refers to an alkyl group substituted with an amino group. In one embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting exemplary (amino)alkyl groups include --CH.sub.2NH.sub.2, --C(CH.sub.3)NH.sub.2, --C(NH.sub.2)(H)CH.sub.3, --CH.sub.2CH.sub.2NH.sub.2, --CH.sub.2C(NH.sub.2)(H)CH.sub.3, --CH.sub.2CH.sub.2CH.sub.2NH.sub.2, --CH.sub.2CH.sub.2CH.sub.2CH.sub.2NH.sub.2, and --CH.sub.2C(CH.sub.3).sub.2CH.sub.2NH.sub.2.

For the purpose of the present disclosure, the term "(alkylamino)alkyl" as used by itself or as part of another group refers to an alkyl group substituted with an alkylamino group. In one embodiment, the alkyl is a C.sub.1-4 alkyl. A non-limiting exemplary (alkylamino)alkyl group is --CH.sub.2CH.sub.2N(H)CH.sub.3.

For the purpose of the present disclosure, the term "(dialkylamino)alkyl" as used by itself or as part of another group refers to an alkyl group substituted by a dialkylamino group. In one embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting exemplary (dialkylamino)alkyl groups are --CH.sub.2CH.sub.2N(CH.sub.3).sub.2.

For the purpose of the present disclosure, the term "(cycloalkylamino)alkyl" as used by itself or as part of another group refers to an alkyl group substituted by a cycloalkylamino group. In one embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting exemplary (cycloalkylamino)alkyl groups include --CH.sub.2N(H)cyclopropyl, --CH.sub.2N(H)cyclobutyl, and --CH.sub.2N(H)cyclohexyl.

For the purpose of the present disclosure, the term "[(cycloalkyl)alkylamino]alkyl" as used by itself or as part of another group refers to an alkyl group substituted by a (cycloalkyl)alkylamino group. In one embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting exemplary ([(cycloalkyl)alkylamino]alkyl groups include:

##STR01090##

For the purpose of the present disclosure, the term "[(heterocyclo)alkylamino]alkyl" as used by itself or as part of another group refers to an alkyl group substituted by a (heterocyclo)alkylamino group. In one embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting exemplary ([(heterocyclo)alkylamino]alkyl groups include:

##STR01091##

For the purpose of the present disclosure, the term "(aralkylamino)alkyl" as used by itself or as part of another group refers to an alkyl group substituted with an aralkylamino group. In one embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting exemplary (aralkylamino)alkyl groups include --CH.sub.2CH.sub.2CH.sub.2N(H)CH.sub.2Ph and --CH.sub.2CH.sub.2CH.sub.2N(H)CH.sub.2(4-CF.sub.3-Ph).

For the purpose of the present disclosure, the term "(cyano)alkyl" as used by itself or as part of another group refers to an alkyl group substituted with one or more cyano, e.g., --CN, groups. In one embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting exemplary (cyano)alkyl groups include --CH.sub.2CH.sub.2CN, --CH.sub.2CH.sub.2CH.sub.2CN, and --CH.sub.2CH.sub.2CH.sub.2CH.sub.2CN.

For the purpose of the present disclosure, the term "(amino)(hydroxy)alkyl" as used by itself or as part of another group refers to an alkyl group substituted with one amino, alkylamino, or dialkylamino group and one hydroxy group. In one embodiment, the alkyl is a C.sub.1-6 alkyl. In another embodiment, the alkyl is a C.sub.1-4 alkyl. Non-limiting exemplary (amino)(hydroxy)alkyl groups include:

##STR01092##

For the purpose of the present disclosure, the term "(amino)(aryl)alkyl" as used by itself or as part of another group refers to an alkyl group substituted with one amino, alkylamino, or dialkylamino group and one optionally substituted aryl group. In one embodiment, the alkyl is a C.sub.1-6 alkyl. In one embodiment, the optionally substituted aryl group is an optionally substituted phenyl. Non-limiting exemplary (amino)(aryl)alkyl groups include:

##STR01093##

For the purpose of the present disclosure, the term "(cycloalkyl)alkyl" as used by itself or as part of another group refers to an alkyl group substituted with one optionally substituted cycloalkyl group. In one embodiment, the alkyl is a C.sub.1-4 alkyl. In one embodiment, the cycloalkyl is a C.sub.3-6 cycloalkyl. In one embodiment, the optionally substituted cycloalkyl group is substituted with an amino or (amino)alkyl group. Non-limiting exemplary (cycloalkyl)alkyl groups include:

##STR01094##

For the purpose of the present disclosure, the term "(hydroxy)(aryl)alkyl" as used by itself or as part of another group refers to an alkyl group substituted with one hydroxy group and one optionally substituted aryl group. In one embodiment, the alkyl is a C.sub.1-6 alkyl. In one embodiment, the optionally substituted aryl group is an optionally substituted phenyl. Non-limiting exemplary (hydroxy)(aryl)alkyl groups include:

##STR01095##

For the purpose of the present disclosure, the term "carboxamido" as used by itself or as part of another group refers to a radical of formula --C(.dbd.O)NR.sup.26aR.sup.26b, wherein R.sup.26a and R.sup.26b are each independently hydrogen, optionally substituted alkyl, optionally substituted aryl, or optionally substituted heteroaryl, or R.sup.26a and R.sup.26b taken together with the nitrogen to which they are attached from a 3- to 8-membered heterocyclo group. In one embodiment, R.sup.26a and R.sup.26b are each independently hydrogen or optionally substituted alkyl. Non-limiting exemplary carboxamido groups include --CONH.sub.2, --CON(H)CH.sub.3, CON(CH.sub.3).sub.2, and --CON(H)Ph.

For the purpose of the present disclosure, the term "(carboxamido)alkyl" as used by itself or as part of another group refers to an alkyl group substituted with a carboxamido group. Non-limiting exemplary (carboxamido)alkyl groups include --CH.sub.2CONH.sub.2, --C(H)CH.sub.3--CONH.sub.2, and --CH.sub.2CON(H)CH.sub.3.

For the purpose of the present disclosure, the term "sulfonamido" as used by itself or as part of another group refers to a radical of the formula --SO.sub.2NR.sup.27aR.sup.27b, wherein R.sup.27a and R.sup.27b are each independently hydrogen, optionally substituted alkyl, or optionally substituted aryl, or R.sup.27a and R.sup.27b taken together with the nitrogen to which they are attached from a 3- to 8-membered heterocyclo group. Non-limiting exemplary sulfonamido groups include --SO.sub.2NH.sub.2, --SO.sub.2N(H)CH.sub.3, and --SO.sub.2N(H)Ph.

For the purpose of the present disclosure, the term "alkylcarbonyl" as used by itself or as part of another group refers to a carbonyl group, i.e., --C(.dbd.O)--, substituted by an alkyl group. A non-limiting exemplary alkylcarbonyl group is --COCH.sub.3.

For the purpose of the present disclosure, the term "arylcarbonyl" as used by itself or as part of another group refers to a carbonyl group, i.e., --C(.dbd.O)--, substituted by an optionally substituted aryl group. A non-limiting exemplary arylcarbonyl group is --COPh.

For the purpose of the present disclosure, the term "alkylsulfonyl" as used by itself or as part of another group refers to a sulfonyl group, i.e., --SO.sub.2--, substituted by any of the above-mentioned optionally substituted alkyl groups. A non-limiting exemplary alkylsulfonyl group is --SO.sub.2CH.sub.3.

For the purpose of the present disclosure, the term "arylsulfonyl" as used by itself or as part of another group refers to a sulfonyl group, i.e., --SO.sub.2--, substituted by any of the above-mentioned optionally substituted aryl groups. A non-limiting exemplary arylsulfonyl group is --SO.sub.2Ph.

For the purpose of the present disclosure, the term "mercaptoalkyl" as used by itself or as part of another group refers to any of the above-mentioned alkyl groups substituted by a --SH group.

For the purpose of the present disclosure, the term "carboxy" as used by itself or as part of another group refers to a radical of the formula --COOH.

For the purpose of the present disclosure, the term "carboxyalkyl" as used by itself or as part of another group refers to any of the above-mentioned alkyl groups substituted with a --COOH. A non-limiting exemplary carboxyalkyl group is --CH.sub.2CO.sub.2H.

For the purpose of the present disclosure, the term "alkoxycarbonyl" as used by itself or as part of another group refers to a carbonyl group, i.e., --C(.dbd.O)--, substituted by an alkoxy group. In one embodiment, the alkoxy group is a C.sub.1-4 alkoxy. Non-limiting exemplary alkoxycarbonyl groups are --CO.sub.2Me and --CO.sub.2Et.

For the purpose of the present disclosure, the term "aralkyl" or "arylalkyl" as used by itself or as part of another group refers to an alkyl group substituted with one, two, or three optionally substituted aryl groups. In one embodiment, the aralkyl group is a C.sub.1-4 alkyl substituted with one optionally substituted aryl group. Non-limiting exemplary aralkyl groups include benzyl, phenethyl, --CHPh.sub.2, --CH.sub.2(4-OH-Ph), and --CH(4-F-Ph).sub.2.

For the purpose of the present disclosure, the term "ureido" as used by itself or as part of another group refers to a radical of the formula --NR.sup.30a--C(.dbd.O)--NR.sup.30bR.sup.30c, wherein R.sup.30a is hydrogen, alkyl, or optionally substituted aryl, and R.sup.30b and R.sup.30c are each independently hydrogen, alkyl, or optionally substituted aryl, or R.sup.30b and R.sup.30c taken together with the nitrogen to which they are attached form a 4- to 8-membered heterocyclo group. Non-limiting exemplary ureido groups include --NH--C(C.dbd.O)--NH.sub.2 and --NH--C(C.dbd.O)--NHCH.sub.3.

For the purpose of the present disclosure, the term "guanidino" as used by itself or as part of another group refers to a radical of the formula --NR.sup.28a--C(NR.sup.29)--NR.sup.28bR.sup.28c, wherein R.sup.28a, R.sup.28b, and R.sup.28c are each independently hydrogen, alkyl, or optionally substituted aryl, and R.sup.29 is hydrogen, alkyl, cyano, alkylsulfonyl, alkylcarbonyl, carboxamido, or sulfonamido. Non-limiting exemplary guanidino groups include --NH--C(C.dbd.NH)--NH.sub.2, --NH--C(C.dbd.NCN)--NH.sub.2, and --NH--C(C.dbd.NH)--NHCH.sub.3.

For the purpose of the present disclosure, the term "(heterocyclo)alkyl" as used by itself or as part of another group refers to an alkyl group substituted with one, two, or three optionally substituted heterocyclo groups. In one embodiment, the (heterocyclo)alkyl is a C.sub.1-4 alkyl substituted with one optionally substituted heterocyclo group. The heterocyclo can be linked to the alkyl group through a carbon or nitrogen atom. Non-limiting exemplary (heterocyclo)alkyl groups include:

##STR01096##

For the purpose of the present disclosure, the term "(heteroaryl)alkyl" or "heteroaralkyl" as used by itself or as part of another group refers to an alkyl group substituted with one, two, or three optionally substituted heteroaryl groups. In one embodiment, the (heteroaryl)alkyl group is a C.sub.1-4 alkyl substituted with one optionally substituted heteroaryl group. Non-limiting exemplary (heteroaryl)alkyl groups include:

##STR01097##

For the purpose of the present disclosure, the term "alkylcarbonylamino" as used by itself or as part of another group refers to an alkylcarbonyl group attached to an amino. A non-limiting exemplary alkylcarbonylamino group is --NHCOCH.sub.3.

For the purpose of the present disclosure, the term "C.sub.1-4 bridge" refers to a --CH.sub.2--, --(CH.sub.2).sub.2--, --(CH.sub.2).sub.3--, or --(CH.sub.2).sub.4-- group that joins two carbon atoms of a piperidine to form an azabicyclo group. For example, in Formula I, R.sup.3a and R.sup.4a of B can be taken together to form a 6-azabicyclo[3.1.1]heptane, 8-azabicyclo[3.2.1]octane, 9-azabicyclo[3.3.1]nonane, or 10-azabicyclo[4.3.1]decane group. Each methylene unit of the C.sub.1-4 bridge can be optionally substituted with one or two substituents independently selected from the group consisting of C.sub.1-4 alkyl and halo.

The present disclosure encompasses any of the Compounds of the Disclosure being isotopically-labelled (i.e., radiolabeled) by having one or more atoms replaced by an atom having a different atomic mass or mass number. Examples of isotopes that can be incorporated into the disclosed compounds include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine and chlorine, such as .sup.2H (or deuterium (D)), .sup.3H, .sup.11C, .sup.13C, .sup.14C, .sup.15N, .sup.18O, .sup.17O, .sup.31P, .sup.32P, .sup.35S, .sup.18F, and .sup.36Cl, respectively, e.g., .sup.3H, .sup.11C, and .sup.14C. In one embodiment, provided is a composition wherein substantially all of the atoms at a position within the Compound of the Disclosure are replaced by an atom having a different atomic mass or mass number. In another embodiment, provided is a composition wherein a portion of the atoms at a position within the Compound of the disclosure are replaced, i.e., the Compound of the Disclosure is enriched at a position with an atom having a different atomic mass or mass number." Isotopically-labelled Compounds of the Disclosure can be prepared by methods known in the art.

Compounds of the Disclosure may contain one or more asymmetric centers and may thus give rise to enantiomers, diastereomers, and other stereoisomeric forms. The present disclosure is meant to encompass the use of all such possible forms, as well as their racemic and resolved forms and mixtures thereof. The individual enantiomers can be separated according to methods known in the art in view of the present disclosure. When the compounds described herein contain olefinic double bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that they include both E and Z geometric isomers. All tautomers are intended to be encompassed by the present disclosure as well.

As used herein, the term "stereoisomers" is a general term for all isomers of individual molecules that differ only in the orientation of their atoms in space. It includes enantiomers and isomers of compounds with more than one chiral center that are not mirror images of one another (diastereomers).

The term "chiral center" or "asymmetric carbon atom" refers to a carbon atom to which four different groups are attached.

The terms "enantiomer" and "enantiomeric" refer to a molecule that cannot be superimposed on its mirror image and hence is optically active wherein the enantiomer rotates the plane of polarized light in one direction and its mirror image compound rotates the plane of polarized light in the opposite direction.

The term "racemic" refers to a mixture of equal parts of enantiomers and which mixture is optically inactive. In one embodiment, Compounds of the Disclosure are racemic.

The term "absolute configuration" refers to the spatial arrangement of the atoms of a chiral molecular entity (or group) and its stereochemical description, e.g., R or S.

The stereochemical terms and conventions used in the specification are meant to be consistent with those described in Pure & Appl. Chem 68:2193 (1996), unless otherwise indicated.

The term "enantiomeric excess" or "ee" refers to a measure for how much of one enantiomer is present compared to the other. For a mixture of R and S enantiomers, the percent enantiomeric excess is defined as |R-S|*100, where R and S are the respective mole or weight fractions of enantiomers in a mixture such that R+S=1. With knowledge of the optical rotation of a chiral substance, the percent enantiomeric excess is defined as ([.alpha.].sub.obs/[.alpha.].sub.max)*100, where [.alpha.].sub.obs is the optical rotation of the mixture of enantiomers and [.alpha.].sub.max is the optical rotation of the pure enantiomer. Determination of enantiomeric excess is possible using a variety of analytical techniques, including NMR spectroscopy, chiral column chromatography or optical polarimetry.

The terms "enantiomerically pure" or "enantiopure" refer to a sample of a chiral substance all of whose molecules (within the limits of detection) have the same chirality sense. In one embodiment, Compounds of the Disclosure are enantiomerically pure.

The terms "enantiomerically enriched" or "enantioenriched" refer to a sample of a chiral substance whose enantiomeric ratio is greater than 50:50. In one embodiment, Compounds of the Disclosure are enantiomerically enriched, e.g., the enantiomeric ratio is about 60:40 or greater, about 70:30 or greater, about 80:20 or greater, about 90:10 or greater, about 95:5 or greater, about 98:2 or greater, or about 99:1 or greater. Enantiomerically enriched compounds may be enantiomerically pure.

The terms "a" and "an" refer to one or more.

The term "about," as used herein, includes the recited number .+-.10%. Thus, "about 10" means 9 to 11.

The present disclosure encompasses the preparation and use of salts of the Compounds of the Disclosure, including non-toxic pharmaceutically acceptable salts. Examples of pharmaceutically acceptable addition salts include inorganic and organic acid addition salts and basic salts. The pharmaceutically acceptable salts include, but are not limited to, metal salts such as sodium salt, potassium salt, cesium salt and the like; alkaline earth metals such as calcium salt, magnesium salt and the like; organic amine salts such as triethylamine salt, pyridine salt, picoline salt, ethanolamine salt, triethanolamine salt, dicyclohexylamine salt, N,N'-dibenzylethylenediamine salt and the like; inorganic acid salts such as hydrochloride, hydrobromide, phosphate, sulphate and the like; organic acid salts such as citrate, lactate, tartrate, maleate, fumarate, mandelate, acetate, dichloroacetate, trifluoroacetate, oxalate, formate and the like; sulfonates such as methanesulfonate, benzenesulfonate, p-toluenesulfonate and the like; and amino acid salts such as arginate, asparginate, glutamate and the like. The term "pharmaceutically acceptable salt" as used herein, refers to any salt, e.g., obtained by reaction with an acid or a base, of a Compound of the Disclosure that is physiologically tolerated in the target patient (e.g., a mammal, e.g., a human).

Acid addition salts can be formed by mixing a solution of the particular Compound of the Disclosure with a solution of a pharmaceutically acceptable non-toxic acid such as hydrochloric acid, fumaric acid, maleic acid, succinic acid, acetic acid, citric acid, tartaric acid, carbonic acid, phosphoric acid, oxalic acid, dichloroacetic acid, or the like. Basic salts can be formed by mixing a solution of the compound of the present disclosure with a solution of a pharmaceutically acceptable non-toxic base such as sodium hydroxide, potassium hydroxide, choline hydroxide, sodium carbonate and the like.

The present disclosure encompasses the preparation and use of solvates of Compounds of the Disclosure. Solvates typically do not significantly alter the physiological activity or toxicity of the compounds, and as such may function as pharmacological equivalents. The term "solvate" as used herein is a combination, physical association and/or solvation of a compound of the present disclosure with a solvent molecule such as, e.g. a disolvate, monosolvate or hemisolvate, where the ratio of solvent molecule to compound of the present disclosure is about 2:1, about 1:1 or about 1:2, respectively. This physical association involves varying degrees of ionic and covalent bonding, including hydrogen bonding. In certain instances, the solvate can be isolated, such as when one or more solvent molecules are incorporated into the crystal lattice of a crystalline solid. Thus, "solvate" encompasses both solution-phase and isolatable solvates. Compounds of the Disclosure can be present as solvated forms with a pharmaceutically acceptable solvent, such as water, methanol, ethanol, and the like, and it is intended that the disclosure includes both solvated and unsolvated forms of Compounds of the Disclosure. One type of solvate is a hydrate. A "hydrate" relates to a particular subgroup of solvates where the solvent molecule is water. Solvates typically can function as pharmacological equivalents. Preparation of solvates is known in the art. See, for example, M. Caira et al, J. Pharmaceut. Sci., 93(3):601-611 (2004), which describes the preparation of solvates of fluconazole with ethyl acetate and with water. Similar preparation of solvates, hemisolvates, hydrates, and the like are described by E. C. van Tonder et al., AAPS Pharm. Sci. Tech., 5(1):Article 12 (2004), and A. L. Bingham et al., Chem. Commun. 603-604 (2001). A typical, non-limiting, process of preparing a solvate would involve dissolving a Compound of the Disclosure in a desired solvent (organic, water, or a mixture thereof) at temperatures above 20.degree. C. to about 25.degree. C., then cooling the solution at a rate sufficient to form crystals, and isolating the crystals by known methods, e.g., filtration. Analytical techniques such as infrared spectroscopy can be used to confirm the presence of the solvent in a crystal of the solvate.

Since Compounds of the Disclosure are inhibitors of SMYD proteins, such as SMYD3 and SMYD2, a number of diseases, conditions, or disorders mediated by SMYD proteins, such as SMYD3 and SMYD2, can be treated by employing these compounds. The present disclosure is thus directed generally to a method for treating a disease, condition, or disorder responsive to the inhibition of SMYD proteins, such as SMYD3 and SMYD2, in an animal suffering from, or at risk of suffering from, the disorder, the method comprising administering to the animal an effective amount of one or more Compounds of the Disclosure.

The present disclosure is further directed to a method of inhibiting SMYD proteins in an animal in need thereof, the method comprising administering to the animal a therapeutically effective amount of at least one Compound of the Disclosure.

The present disclosure is further directed to a method of inhibiting SMYD3 in an animal in need thereof, the method comprising administering to the animal a therapeutically effective amount of at least one Compound of the Disclosure.

The present disclosure is further directed to a method of inhibiting SMYD2 in an animal in need thereof, the method comprising administering to the animal a therapeutically effective amount of at least one Compound of the Disclosure.

As used herein, the terms "treat," "treating," "treatment," and the like refer to eliminating, reducing, or ameliorating a disease or condition, and/or symptoms associated therewith. Although not precluded, treating a disease or condition does not require that the disease, condition, or symptoms associated therewith be completely eliminated. As used herein, the terms "treat," "treating," "treatment," and the like may include "prophylactic treatment," which refers to reducing the probability of redeveloping a disease or condition, or of a recurrence of a previously-controlled disease or condition, in a subject who does not have, but is at risk of or is susceptible to, redeveloping a disease or condition or a recurrence of the disease or condition. The term "treat" and synonyms contemplate administering a therapeutically effective amount of a Compound of the Disclosure to an individual in need of such treatment.

Within the meaning of the disclosure, "treatment" also includes relapse prophylaxis or phase prophylaxis, as well as the treatment of acute or chronic signs, symptoms and/or malfunctions. The treatment can be orientated symptomatically, for example, to suppress symptoms. It can be effected over a short period, be oriented over a medium term, or can be a long-term treatment, for example within the context of a maintenance therapy.

The term "therapeutically effective amount" or "effective dose" as used herein refers to an amount of the active ingredient(s) that is(are) sufficient, when administered by a method of the disclosure, to efficaciously deliver the active ingredient(s) for the treatment of condition or disease of interest to an individual in need thereof. In the case of a cancer or other proliferation disorder, the therapeutically effective amount of the agent may reduce (i.e., retard to some extent and preferably stop) unwanted cellular proliferation; reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., retard to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., retard to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; modulate protein methylation in the target cells; and/or relieve, to some extent, one or more of the symptoms associated with the cancer. To the extent the administered compound or composition prevents growth and/or kills existing cancer cells, it may be cytostatic and/or cytotoxic.

The term "container" means any receptacle and closure therefore suitable for storing, shipping, dispensing, and/or handling a pharmaceutical product.

The term "insert" means information accompanying a pharmaceutical product that provides a description of how to administer the product, along with the safety and efficacy data required to allow the physician, pharmacist, and patient to make an informed decision regarding use of the product. The package insert generally is regarded as the "label" for a pharmaceutical product.

The term "disease" or "condition" or "disorder" denotes disturbances and/or anomalies that as a rule are regarded as being pathological conditions or functions, and that can manifest themselves in the form of particular signs, symptoms, and/or malfunctions. As demonstrated below, Compounds of the Disclosure inhibit SMYD proteins, such as SMYD3 and SMYD2 and can be used in treating diseases and conditions such as proliferative diseases, wherein inhibition of SMYD proteins, such as SMYD3 and SMYD2 provides a benefit.

In some embodiments, the Compounds of the Disclosure can be used to treat a "SMYD protein mediated disorder" (e.g., a SMYD3-mediated disorder or a SMYD2-mediated disorder). A SMYD protein mediated disorder is any pathological condition in which a SMYD protein is know to play a role. In some embodiments, a SMYD-mediated disorder is a proliferative disease.

In some embodiments inhibiting SMYD proteins, such as SMYD3 and SMYD2, is the inhibition of the activity of one or more activities of SMYD proteins such as SMYD3 and SMYD2. In some embodiments, the activity of the SMYD proteins such as SMYD3 and SMYD2 is the ability of the SMYD protein such as SMYD3 or SMYD2 to transfer a methyl group to a target protein (e.g., histone). It should be appreciated that the activity of the one or more SMYD proteins such as SMYD3 and SMYD2 may be inhibited in vitro or in vivo. Exemplary levels of inhibition of the activity one or more SMYD proteins such as SMYD3 and SMYD2 include at least 10% inhibition, at least 20% inhibition, at least 30% inhibition, at least 40% inhibition, at least 50% inhibition, at least 60% inhibition, at least 70% inhibition, at least 80% inhibition, at least 90% inhibition, and up to 100% inhibition.

The SMYD (SET and MYND domain) family of lysine methyltransferases (KMTs) plays pivotal roles in various cellular processes, including gene expression regulation and DNA damage response. The family of human SMYD proteins consists of SMYD1, SMYD2, SMYD3, SMYD4 and SMYD5. SMYD1, SMYD2, and SMYD3 share a high degree of sequence homology and, with the exception of SMYD5, human SMYD proteins harbor at least one C-terminal tetratrico peptide repeat (TPR) domain. (See e.g., Abu-Farha et al. J Mol Cell Biol (2011) 3 (5) 301-308). The SMYD proteins have been found to be linked to various cancers (See e.g., Hamamoto et al. Nat Cell. Biol. 2004, 6: 731-740), Hu et al. Canncer Research 2009, 4067-4072, and Komatsu et al. Carcinogenesis 2009, 301139-1146.)

SMYD3 is a protein methyltransferase found to be expressed at high levels in a number of different cancers (Hamamoto, R., et al., Nat. Cell Biol., 6(8):731-40 (2004)). SMYD3 likely plays a role in the regulation of gene transcription and signal transduction pathways critical for survival of breast, liver, prostate and lung cancer cell lines (Hamamoto, R., et al., Nat. Cell Biol., 6(8):731-40 (2004); Hamamoto, R., et al., Cancer Sci., 97(2):113-8 (2006); Van Aller, G. S., et al., Epigenetics, 7(4):340-3 (2012); Liu, C., et al., J. Natl. Cancer Inst., 105(22):1719-28 (2013); Mazur, P. K., et al., Nature, 510(7504):283-7 (2014)).

Genetic knockdown of SMYD3 leads to a decrease in proliferation of a variety of cancer cell lines (Hamamoto, R., et al., Nat. Cell Biol., 6(8):731-40 (2004); Hamamoto, R., et al., Cancer Sci., 97(2):113-8 (2006); Van Aller, G. S., et al., Epigenetics, 7(4):340-3 (2012); Liu, C., et al., J. Natl. Cancer Inst., 105(22):1719-28 (2013); Mazur, P. K., et al., Nature, 510(7504):283-7 (2014)). Several studies employing RNAi-based technologies have shown that ablation of SMYD3 in hepatocellular carcinoma cell lines greatly reduces cell viability and that its pro-survival role is dependent on its catalytic activity (Hamamoto, R., et al., Nat. Cell Biol., 6(8):731-40 (2004); Van Aller, G. S., et al., Epigenetics, 7(4):340-3 (2012)). Moreover, SMYD3 has also been shown to be a critical mediator of transformation resulting from gain of function mutations in the oncogene, KRAS for both pancreatic and lung adenocarcinoma in mouse models. The dependence of KRAS on SMYD3 was also shown to be dependent on its catalytic activity (Mazur, P. K., et al., Nature, 510(7504):283-7 (2014)). SMYD3 function has also been implicated in colorectal cancers and RNAi mediated knockdown of SMYD3 has been shown to impair colorectal cell proliferation. (Peserico et al., Cell Physiol. 2015 Feb. 28. doi: 10.1002/jcp.24975. [Epub ahead of print]).

Furthermore, SMYD3 function has also been shown to play a role in immunology and development. For instance, de Almeida reported that SMYD3 plays a role in generation of inducible regulatory T cells (iTreg) cells. In a mouse model of respiratory syncytial virus (RSV) infection, a model in which iTreg cells have a critical role in regulating lung pathogenesis, SMYD3-/- mice demonstrated exacerbation of RSV-induced disease related to enhanced proinflammatory responses and worsened pathogenesis within the lung (de Almeida et al. Mucosal Immunol. 2015 Feb. 11. doi: 10.1038/mi.2015.4. [Epub ahead of print]). In addition, as to development, Proserpio et al. have shown the importance of SMYD3 in the regulation of skeletal muscle atrophy (Proserpio et al. Genes Dev. 2013 Jun. 1; 27(11):1299-312), while Fujii et al. have elucidated the role of SMYD3 in cardiac and skeletal muscle development (Fujii et al. PLoS One. 2011; 6(8): e23491).

SMYD2 (SET and MYND domain-containing protein 2) was first characterized as protein that is a member of a sub-family of SET domain containing proteins which catalyze the site-specific transfer of methyl groups onto substrate proteins. SMYD2 was initially shown to have methyltransferase activity towards lysine 36 on histone H3 (H3K36) but has subsequently been shown to have both histone and non-histone methyltrasferase activity.

SMYD2 has been implicated in the pathogenesis of multiple cancers. It has been shown to be over-expressed, compared to matched normal samples, in tumors of the breast, cervix, colon, kidney, liver, head and neck, skin, pancreas, ovary, esophagus and prostate, as well as hematologic malignancies such as AML, B- and T-ALL, CLL and MCL, suggesting a role for SMYD2 in the biology of these cancers. More specifically, studies using genetic knock-down of SMYD2 have demonstrated anti-proliferative effects in esophageal squamous cell carcinoma (ESCC), bladder carcinoma and cervical carcinoma cell lines. (See e.g., Komatsu et al., Carcinogenesis 2009, 30, 1139, and Cho et al., Neoplasia. 2012 June; 14(6):476-86). Moreover, high expression of SMYD2 has been shown to be a poor prognostic factor in both ESCC and pediatric ALL. (See e.g., Komatsu et al. Br J Cancer. 2015 Jan. 20; 112(2):357-64, and Sakamoto et al., Leuk Res. 2014 April; 38(4):496-502). Recently, Nguyen et al., have shown that a small molecule inhibitor of SMYD2 (LLY-507) inhibited the proliferation of several esophageal, liver and breast cancer cell lines in a dose-dependent manner. (Nguyen et al. J Biol Chem. 2015 Mar. 30. pii: jbc.M114.626861. [Epub ahead of print]).

SMYD2 has also been implicated in immunology. For instance, Xu et al. have shown that SMYD2 is a negative regulator of macrophage activation by suppressing Interleukin-6 and TNF-alpha production. (Xu et al., J Biol Chem. 2015 Feb. 27; 290(9):5414-23).

In one aspect, the present disclosure provides a method of treating cancer in a patient comprising administering a therapeutically effective amount of a Compound of the Disclosure. While not being limited to a specific mechanism, in some embodiments, Compounds of the Disclosure can treat cancer by inhibiting SMYD proteins, such as SMYD3 and SMYD2. Examples of treatable cancers include, but are not limited to, adrenal cancer, acinic cell carcinoma, acoustic neuroma, acral lentigious melanoma, acrospiroma, acute eosinophilic leukemia, acute erythroid leukemia, acute lymphoblastic leukemia, acute megakaryoblastic leukemia, acute monocytic leukemia, acute promyelocytic leukemia, adenocarcinoma, adenoid cystic carcinoma, adenoma, adenomatoid odontogenic tumor, adenosquamous carcinoma, adipose tissue neoplasm, adrenocortical carcinoma, adult T-cell leukemia/lymphoma, aggressive NK-cell leukemia, AIDS-related lymphoma, alveolar rhabdomyosarcoma, alveolar soft part sarcoma, ameloblastic fibroma, anaplastic large cell lymphoma, anaplastic thyroid cancer, angioimmunoblastic T-cell lymphoma, angiomyolipoma, angiosarcoma, astrocytoma, atypical teratoid rhabdoid tumor, B-cell chronic lymphocytic leukemia, B-cell prolymphocytic leukemia, B-cell lymphoma, basal cell carcinoma, biliary tract cancer, bladder cancer, blastoma, bone cancer, Brenner tumor, Brown tumor, Burkitt's lymphoma, breast cancer, brain cancer, carcinoma, carcinoma in situ, carcinosarcoma, cartilage tumor, cementoma, myeloid sarcoma, chondroma, chordoma, choriocarcinoma, choroid plexus papilloma, clear-cell sarcoma of the kidney, craniopharyngioma, cutaneous T-cell lymphoma, cervical cancer, colorectal cancer, Degos disease, desmoplastic small round cell tumor, diffuse large B-cell lymphoma, dysembryoplastic neuroepithelial tumor, dysgerminoma, embryonal carcinoma, endocrine gland neoplasm, endodermal sinus tumor, enteropathy-associated T-cell lymphoma, esophageal cancer, fetus in fetu, fibroma, fibrosarcoma, follicular lymphoma, follicular thyroid cancer, ganglioneuroma, gastrointestinal cancer, germ cell tumor, gestational choriocarcinoma, giant cell fibroblastoma, giant cell tumor of the bone, glial tumor, glioblastoma multiforme, glioma, gliomatosis cerebri, glucagonoma, gonadoblastoma, granulosa cell tumor, gynandroblastoma, gallbladder cancer, gastric cancer, hairy cell leukemia, hemangioblastoma, head and neck cancer, hemangiopericytoma, hematological malignancy, hepatoblastoma, hepatosplenic T-cell lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma, invasive lobular carcinoma, intestinal cancer, kidney cancer, laryngeal cancer, lentigo maligna, lethal midline carcinoma, leukemia, leydig cell tumor, liposarcoma, lung cancer, lymphangioma, lymphangiosarcoma, lymphoepithelioma, lymphoma, acute lymphocytic leukemia, acute myelogeous leukemia, chronic lymphocytic leukemia, liver cancer, small cell lung cancer, non-small cell lung cancer, MALT lymphoma, malignant fibrous histiocytoma, malignant peripheral nerve sheath tumor, malignant triton tumor, mantle cell lymphoma, marginal zone B-cell lymphoma, mast cell leukemia, mediastinal germ cell tumor, medullary carcinoma of the breast, medullary thyroid cancer, medulloblastoma, melanoma, meningioma, merkel cell cancer, mesothelioma, metastatic urothelial carcinoma, mixed Mullerian tumor, mucinous tumor, multiple myeloma, muscle tissue neoplasm, mycosis fungoides, myxoid liposarcoma, myxoma, myxosarcoma, nasopharyngeal carcinoma, neurinoma, neuroblastoma, neurofibroma, neuroma, nodular melanoma, ocular cancer, oligoastrocytoma, oligodendroglioma, oncocytoma, optic nerve sheath meningioma, optic nerve tumor, oral cancer, osteosarcoma, ovarian cancer, Pancoast tumor, papillary thyroid cancer, paraganglioma, pinealoblastoma, pineocytoma, pituicytoma, pituitary adenoma, pituitary tumor, plasmacytoma, polyembryoma, precursor T-lymphoblastic lymphoma, primary central nervous system lymphoma, primary effusion lymphoma, preimary peritoneal cancer, prostate cancer, pancreatic cancer, pharyngeal cancer, pseudomyxoma periotonei, renal cell carcinoma, renal medullary carcinoma, retinoblastoma, rhabdomyoma, rhabdomyosarcoma, Richter's transformation, rectal cancer, sarcoma, Schwannomatosis, seminoma, Sertoli cell tumor, sex cord-gonadal stromal tumor, signet ring cell carcinoma, skin cancer, small blue round cell tumors, small cell carcinoma, soft tissue sarcoma, somatostatinoma, soot wart, spinal tumor, splenic marginal zone lymphoma, squamous cell carcinoma, synovial sarcoma, Sezary's disease, small intestine cancer, squamous carcinoma, stomach cancer, T-cell lymphoma, testicular cancer, thecoma, thyroid cancer, transitional cell carcinoma, throat cancer, urachal cancer, urogenital cancer, urothelial carcinoma, uveal melanoma, uterine cancer, verrucous carcinoma, visual pathway glioma, vulvar cancer, vaginal cancer, Waldenstrom's macroglobulinemia, Warthin's tumor, and Wilms' tumor.

In another embodiment, the cancer is breast, cervix, colon, kidney, liver, head and neck, skin, pancreas, ovary, esophagus, or prostate cancer.

In another embodiment, the cancer is a hematologic malignancy such as acute myeloid leukemia (AML), B- and T-acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), or mantle cell lymphoma (MCL).

In another embodiment, the cancer is esophageal squamous cell carcinoma (ESCC), bladder carcinoma, or cervical carcinoma.

In another embodiment, the cancer is a leukemia, for example a leukemia selected from acute monocytic leukemia, acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia and mixed lineage leukemia (MLL). In another embodiment the cancer is NUT-midline carcinoma. In another embodiment the cancer is multiple myeloma. In another embodiment the cancer is a lung cancer such as small cell lung cancer (SCLC). In another embodiment the cancer is a neuroblastoma. In another embodiment the cancer is Burkitt's lymphoma. In another embodiment the cancer is cervical cancer. In another embodiment the cancer is esophageal cancer. In another embodiment the cancer is ovarian cancer. In another embodiment the cancer is colorectal cancer. In another embodiment, the cancer is prostate cancer. In another embodiment, the cancer is breast cancer.

In another embodiment, the present disclosure provides a therapeutic method of modulating protein methylation, gene expression, cell proliferation, cell differentiation and/or apoptosis in vivo in the cancers mentioned above by administering a therapeutically effective amount of a Compound of the Disclosure to a subject in need of such therapy.

Compounds of the Disclosure can be administered to a mammal in the form of a raw chemical without any other components present. Compounds of the Disclosure can also be administered to a mammal as part of a pharmaceutical composition containing the compound combined with a suitable pharmaceutically acceptable carrier. Such a carrier can be selected from pharmaceutically acceptable excipients and auxiliaries. The term "pharmaceutically acceptable carrier" or "pharmaceutically acceptable vehicle" encompasses any of the standard pharmaceutical carriers, solvents, surfactants, or vehicles. Suitable pharmaceutically acceptable vehicles include aqueous vehicles and nonaqueous vehicles. Standard pharmaceutical carriers and their formulations are described in Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., 19th ed. 1995.

Pharmaceutical compositions within the scope of the present disclosure include all compositions where a Compound of the Disclosure is combined with one or more pharmaceutically acceptable carriers. In one embodiment, the Compound of the Disclosure is present in the composition in an amount that is effective to achieve its intended therapeutic purpose. While individual needs may vary, a determination of optimal ranges of effective amounts of each compound is within the skill of the art. Typically, a Compound of the Disclosure can be administered to a mammal, e.g., a human, orally at a dose of from about 0.0025 to about 1500 mg per kg body weight of the mammal, or an equivalent amount of a pharmaceutically acceptable salt or solvate thereof, per day to treat the particular disorder. A useful oral dose of a Compound of the Disclosure administered to a mammal is from about 0.0025 to about 50 mg per kg body weight of the mammal, or an equivalent amount of the pharmaceutically acceptable salt or solvate thereof. For intramuscular injection, the dose is typically about one-half of the oral dose.

A unit oral dose may comprise from about 0.01 mg to about 1 g of the Compound of the Disclosure, e.g., about 0.01 mg to about 500 mg, about 0.01 mg to about 250 mg, about 0.01 mg to about 100 mg, 0.01 mg to about 50 mg, e.g., about 0.1 mg to about 10 mg, of the compound. The unit dose can be administered one or more times daily, e.g., as one or more tablets or capsules, each containing from about 0.01 mg to about 1 g of the compound, or an equivalent amount of a pharmaceutically acceptable salt or solvate thereof.

A pharmaceutical composition of the present disclosure can be administered to any patient that may experience the beneficial effects of a Compound of the Disclosure. Foremost among such patients are mammals, e.g., humans and companion animals, although the disclosure is not intended to be so limited. In one embodiment, the patient is a human.

A pharmaceutical composition of the present disclosure can be administered by any means that achieves its intended purpose. For example, administration can be by the oral, parenteral, subcutaneous, intravenous, intramuscular, intraperitoneal, transdermal, intranasal, transmucosal, rectal, intravaginal or buccal route, or by inhalation. The dosage administered and route of administration will vary, depending upon the circumstances of the particular subject, and taking into account such factors as age, gender, health, and weight of the recipient, condition or disorder to be treated, kind of concurrent treatment, if any, frequency of treatment, and the nature of the effect desired.

In one embodiment, a pharmaceutical composition of the present disclosure can be administered orally. In another embodiment, a pharmaceutical composition of the present disclosure can be administered orally and is formulated into tablets, dragees, capsules, or an oral liquid preparation. In one embodiment, the oral formulation comprises extruded multiparticulates comprising the Compound of the Disclosure.

Alternatively, a pharmaceutical composition of the present disclosure can be administered rectally, and is formulated in suppositories.

Alternatively, a pharmaceutical composition of the present disclosure can be administered by injection.

Alternatively, a pharmaceutical composition of the present disclosure can be administered transdermally.

Alternatively, a pharmaceutical composition of the present disclosure can be administered by inhalation or by intranasal or transmucosal administration.

Alternatively, a pharmaceutical composition of the present disclosure can be administered by the intravaginal route.

A pharmaceutical composition of the present disclosure can contain from about 0.01 to 99 percent by weight, e.g., from about 0.25 to 75 percent by weight, of a Compound of the Disclosure, e.g., about 1%, about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, or about 75% by weight of a Compound of the Disclosure.

A pharmaceutical composition of the present disclosure is manufactured in a manner which itself will be known in view of the instant disclosure, for example, by means of conventional mixing, granulating, dragee-making, dissolving, extrusion, or lyophilizing processes. Thus, pharmaceutical compositions for oral use can be obtained by combining the active compound with solid excipients, optionally grinding the resulting mixture and processing the mixture of granules, after adding suitable auxiliaries, if desired or necessary, to obtain tablets or dragee cores.

Suitable excipients include fillers such as saccharides (for example, lactose, sucrose, mannitol or sorbitol), cellulose preparations, calcium phosphates (for example, tricalcium phosphate or calcium hydrogen phosphate), as well as binders such as starch paste (using, for example, maize starch, wheat starch, rice starch, or potato starch), gelatin, tragacanth, methyl cellulose, hydroxypropylmethylcellulose, sodium carboxymethylcellulose, and/or polyvinyl pyrrolidone. If desired, one or more disintegrating agents can be added, such as the above-mentioned starches and also carboxymethyl-starch, cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof, such as sodium alginate.

Auxiliaries are typically flow-regulating agents and lubricants such as, for example, silica, talc, stearic acid or salts thereof (e.g., magnesium stearate or calcium stearate), and polyethylene glycol. Dragee cores are provided with suitable coatings that are resistant to gastric juices. For this purpose, concentrated saccharide solutions can be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, polyethylene glycol and/or titanium dioxide, lacquer solutions and suitable organic solvents or solvent mixtures. In order to produce coatings resistant to gastric juices, solutions of suitable cellulose preparations such as acetylcellulose phthalate or hydroxypropylmethyl-cellulose phthalate can be used. Dye stuffs or pigments can be added to the tablets or dragee coatings, for example, for identification or in order to characterize combinations of active compound doses.

Examples of other pharmaceutical preparations that can be used orally include push-fit capsules made of gelatin, or soft, sealed capsules made of gelatin and a plasticizer such as glycerol or sorbitol. The push-fit capsules can contain a compound in the form of granules, which can be mixed with fillers such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers, or in the form of extruded multiparticulates. In soft capsules, the active compounds are preferably dissolved or suspended in suitable liquids, such as fatty oils or liquid paraffin. In addition, stabilizers can be added.

Possible pharmaceutical preparations for rectal administration include, for example, suppositories, which consist of a combination of one or more active compounds with a suppository base. Suitable suppository bases include natural and synthetic triglycerides, and paraffin hydrocarbons, among others. It is also possible to use gelatin rectal capsules consisting of a combination of active compound with a base material such as, for example, a liquid triglyceride, polyethylene glycol, or paraffin hydrocarbon.

Suitable formulations for parenteral administration include aqueous solutions of the active compound in a water-soluble form such as, for example, a water-soluble salt, alkaline solution, or acidic solution. Alternatively, a suspension of the active compound can be prepared as an oily suspension. Suitable lipophilic solvents or vehicles for such as suspension may include fatty oils (for example, sesame oil), synthetic fatty acid esters (for example, ethyl oleate), triglycerides, or a polyethylene glycol such as polyethylene glycol-400 (PEG-400). An aqueous suspension may contain one or more substances to increase the viscosity of the suspension, including, for example, sodium carboxymethyl cellulose, sorbitol, and/or dextran. The suspension may optionally contain stabilizers.

In another embodiment, the present disclosure provides kits which comprise a Compound of the Disclosure (or a composition comprising a Compound of the Disclosure) packaged in a manner that facilitates their use to practice methods of the present disclosure. In one embodiment, the kit includes a Compound of the Disclosure (or a composition comprising a Compound of the Disclosure) packaged in a container, such as a sealed bottle or vessel, with a label affixed to the container or included in the kit that describes use of the compound or composition to practice the method of the disclosure. In one embodiment, the compound or composition is packaged in a unit dosage form. The kit further can include a device suitable for administering the composition according to the intended route of administration.

General Synthesis of Compounds

Compounds of the Disclosure are prepared using methods known to those skilled in the art in view of this disclosure, or by the illustrative methods shown in the General Schemes below. In the General Schemes, R.sup.1, R.sup.2a, R.sup.2b, R.sup.3b, R.sup.3b, R.sup.4a, R.sup.5a, and Z of Formulae A-D are as defined in connection with Formula I, unless otherwise indicated. In any of the General Schemes, suitable protecting can be employed in the synthesis, for example, when Z is (amino)alkyl or any other group that may group that may require protection, or when R.sup.8 is amino, (amino)alkyl, or any other group that may require protection. (See, Wuts, P. G. M.; Greene, T. W., "Greene's Protective Groups in Organic Synthesis", 4th Ed., J. Wiley & Sons, N Y, 2007).

##STR01098##

Compound A is converted to compound B (i.e, a compound having Formula I, wherein R.sup.2b, R.sup.3b, R.sup.4b, R.sup.5b, and R.sup.6 are each hydrogen, and X is --S(.dbd.O).sub.2--) by coupling with a suitable sulfonyl chloride (Z--SO.sub.2Cl) in the presence of a suitable base such as TEA or DIPEA in a suitable solvent such as dichloromethane, acetonitrile, or DMF.

##STR01099##

Compound A is converted to compound C (i.e, a compound having Formula I, wherein R.sup.2b, R.sup.3b, R.sup.4b, R.sup.5b, and R.sup.6 are each hydrogen, and X is --C(.dbd.O)--) by coupling with a suitable acide chloride (Z--COCl) in the presence of a suitable base such as TEA or DIPEA in a suitable solvent such as dichloromethane, acetonitrile, or DMF, or by coupling with a suitable carboxylic acid (Z--CO.sub.2H) in the presence of a suitable coupling reagent such as HATU and a suitable base such as TEA or DIPEA in a suitable solvent such as dichloromethane, acetonitrile, or DMF.

##STR01100##

Compound A is converted to compound D (i.e, a compound having Formula I, wherein R.sup.2b, R.sup.3b, R.sup.4b, R.sup.5b, and R.sup.6 are each hydrogen, and X is --C(.dbd.O)C(R.sup.8)(H)--) by coupling with a suitable carboxylic acid (Z--C(H)R.sup.8--CO.sub.2H) in the presence of a suitable coupling reagent such as HATU and a suitable base such as TEA or DIPEA in a suitable solvent such as dichloromethane, acetonitrile, or DMF.

EXAMPLES

General Synthetic Methods

General methods and experimental procedures for preparing and characterizing compounds of Tables 1-3 are set forth in the general schemes above and the examples below. Wherever needed, reactions were heated using conventional hotplate apparatus or heating mantle or microwave irradiation equipment. Reactions were conducted with or without stirring, under atmospheric or elevated pressure in either open or closed vessels. Reaction progress was monitored using conventional techniques such as TLC, HPLC, UPLC, or LCMS using instrumentation and methods described below. Reactions were quenched and crude compounds isolated using conventional methods as described in the specific examples provided. Solvent removal was carried out with or without heating, under atmospheric or reduced pressure, using either a rotary or centrifugal evaporator.

Compound purification was carried out as needed using a variety of traditional methods including, but not limited to, preparative chromatography under acidic, neutral, or basic conditions using either normal phase or reverse phase HPLC or flash columns or Prep-TLC plates. Compound purity and mass confirmations were conducted using standard HPLC and/or UPLC and/or MS spectrometers and/or LCMS and/or GC equipment (i.e., including, but not limited to the following instrumentation: Waters Alliance 2695 with 2996 PDA detector connected with ZQ detector and ESI source; Shimadzu LDMS-2020; Waters Acquity H Class with PDA detector connected with SQ detector and ESI source; Agilent 1100 Series with PDA detector; Waters Alliance 2695 with 2998 PDA detector; AB SCIEX API 2000 with ESI source; Agilent 7890 GC). Exemplified compounds were dissolved in either MeOH or MeCN to a concentration of approximately 1 mg/mL and analyzed by injection of 0.5-10 .mu.L into an appropriate LCMS system using the methods provided in the following table. In each case the flow rate is 1 mL/min. LCMS data are presented in Tables 1A, 2A, and 3A.

TABLE-US-00010 MS MS Heat Detec- Mobile Mobile Block tor Phase Phase Gradient Temp Voltage Method Column A B Profile (.degree. C.) (kV) A Shim- Water/ ACN/ 5% to 100% 250 1.5 pack 0.05% 0.05% B in 2.0 XR-ODS TFA TFA minutes, 2.2 .mu.m 100% B for 3.0 .times. 1.1 minutes, 50 mm 100% to 5% B in 0.2 minutes, then stop B Gemini- Water/ ACN 5% to 100% 200 0.75 NX 3 .mu.m 0.04% B in 2.0 C18 110A Ammonia minutes, 100% B for 1.1 minutes, 100% to 5% B in 0.1 minutes, then stop C Shim- Water/ ACN/ 5% to 100% 250 0.85 pack 0.05% 0.05% B in 2.0 XR-ODS TFA TFA minutes, 1.6 .mu.m 100% B for 2.0 .times. 1.1 minutes, 50 mm 100% to 5% B in 0.1 minutes, then stop D Shim- Water/ ACN/ 5% to 100% 250 0.95 pack 0.05% 0.05% B in 2.0 XR-ODS TFA TFA minutes, 2.2 .mu.m 100% B for 3.0 .times. 1.1 minutes, 50 mm 100% to 5% B in 0.1 minutes, then stop

Compound structure confirmations were carried out using standard 300 or 400 MHz NMR spectrometers with nOe's conducted whenever necessary.

The following abbreviations are used herein:

TABLE-US-00011 Abbreviation Meaning ACN acetonitrile atm. atmosphere DCM dichloromethane DHP dihydropyran DIBAL diisobutyl aluminum hydride DIEA diisopropyl ethylamine DMF dimethyl formamide DMF-DMA dimethyl formamide dimethyl acetal DMSO dimethyl sulfoxide Dppf 1,1'-bis(diphenylphosphino)ferrocene EA ethyl acetate ESI electrospray ionization EtOH Ethanol FA formic acid GC gas chromatography H hour Hex hexanes HMDS hexamethyl disilazide HPLC high performance liquid chromatography IPA Isopropanol LCMS liquid chromatography/mass spectrometry MeOH Methanol Min Minutes NBS N-bromo succinimide NCS N-chloro succinimide NIS N-iodo succinimide NMR nuclear magnetic resonance nOe nuclear Overhauser effect Prep. Preparative PTSA para-toluene sulfonic acid Rf retardation factor rt room temperature RT retention time sat. Saturated SGC silica gel chromatography TBAF tetrabutyl ammonium fluoride TEA Triethylamine TFA trifluoroacetic acid THF Tetrahydrofuran TLC thin layer chromatography UPLC ultra performance liquid chromatography

Example 1

Synthesis of 5-cyclopropylisoxazole-3-carboxylic acid

##STR01101##

Step 1: Synthesis of ethyl 4-cyclopropyl-2,4-dioxobutanoate

##STR01102##

Into a 10-L 3-necked round-bottom flask purged and maintained with an inert atmosphere of nitrogen Na (164 g, 1.20 equiv) was added in portions to ethanol (5 L). A solution of (CO.sub.2Et).sub.2 (869 g, 1.00 equiv) and 1-cyclopropylethan-1-one (500 g, 5.94 mol, 1.00 equiv) was added dropwise with stirring at 0-20.degree. C. The resulting solution was stirred for 1 h at 20-30.degree. C. and then for an additional 1 h at 80.degree. C. The resulting solution was diluted with 15 L of H.sub.2O. The pH was adjusted to 2 with hydrochloric acid (12N). The resulting solution was extracted with ethyl acetate and the organic layers combined and washed with NaHCO.sub.3 (sat. aq.). The extract was concentrated under vacuum yielding 820 g (crude) of ethyl 4-cyclopropyl-2,4-dioxobutanoate as yellow oil. TLC (ethyl acetate/petroleum ether=1/5): Rf=0.5.

Step 2: Synthesis of ethyl 5-cyclopropylisoxazole-3-carboxylate

##STR01103##

Into a 10 L round-bottom flask, was placed a solution of ethyl 4-cyclopropyl-2,4-dioxobutanoate (177 g) in ethanol (1.1 L) and NH.sub.2OH--HCl (200 g). The resulting solution was stirred for 1 h at 20-30.degree. C. The resulting solution was allowed to react, with stirring, for an additional 1 h at 80.degree. C. The resulting mixture was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1/10). This resulted in 143 g (the two step yield was 66.3%) of ethyl 5-cyclopropylisoxazole-3-carboxylate as a yellow oil. TLC (ethyl acetate/petroleum ether=1/5): Rf=0.2.

Step 3: Synthesis of 5-cyclopropylisoxazole-3-carboxylic acid

##STR01104##

Into a 10-L round-bottom flask was placed ethyl 5-cyclopropylisoxazole-3-carboxylate (280 g, 1.55 mol, 1.00 equiv) and a solution of sodium hydroxide (74.3 g, 1.20 equiv) in water (4 L). The resulting solution was stirred for 1 h at room temperature. The resulting mixture was washed with ether. The pH value of the aqueous solution was adjusted to 2-3 with hydrochloric acid (12N). The resulting solution was extracted with ethyl acetate and the organic layers combined and concentrated under vacuum. This resulted in 220 g (93%) of 5-cyclopropylisoxazole-3-carboxylic acid as an off-white solid. LCMS (method A, ESI): RT=1.99 min, m/z=153.9 [M+H].sup.+. .sup.1H-NMR (300 MHz CDCl.sub.3): 8.42 (brs, 1H), 6.37 (s, 1H), 2.16-2.05 (m, 1H), 1.29-1.12 (m, 2H), 1.12-0.99 (m, 2H) ppm.

Example 2

Synthesis of 5-cyclopropyl-N-((2S,4S)-2-methylpiperidin-4-yl)isoxazole-3-carboxamide hydrochloride and 5-cyclopropyl-N-((2S,4R)-2-methylpiperidin-4-yl)isoxazole-3-carboxamide hydrochloride

##STR01105##

Step 1: Synthesis of (2S)-tert-butyl 4-amino-2-methylpiperidine-1-carboxylate

##STR01106##

Into a 10-L round-bottom flask was placed methanol (5 L), HCOONH.sub.4 (190 g, 3.01 mol, 37.80 equiv), acetic acid (5 g, 83.26 mmol, 1.04 equiv) and tert-butyl (2S)-2-methyl-4-oxopiperidine-1-carboxylate (17 g, 79.71 mmol, 1.00 equiv). Then NaBH.sub.3CN (10 g, 159.13 mmol, 2.00 equiv) was added batchwise. The resulting solution was stirred at 25.degree. C. overnight. The resulting mixture was concentrated under vacuum. The resulting solution was diluted with 500 mL of ethyl acetate. The resulting solution was washed with 3.times.500 mL of brine (sat.). This resulted in 15.5 g (91%) of tert-butyl (2S)-4-amino-2-methylpiperidine-1-carboxylate as off-white oil. LCMS (method A, ESI): RT=1.21 min, m/z=215.1 [M+H].sup.+.

Step 2: Synthesis of (2S)-tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-2-methylpiperidine-1-carboxylate

##STR01107##

Into a 1 L round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed dichloromethane (500 mL), HOBT (15 g, 111.01 mmol, 1.53 equiv), EDCI (20 g, 104.33 mmol, 1.44 equiv), 5-cyclopropyl-1,2-oxazole-3-carboxylic acid (13.3 g, 86.85 mmol, 1.20 equiv) and tert-butyl (2S)-4-amino-2-methylpiperidine-1-carboxylate (15.5 g, 72.33 mmol, 1.00 equiv). Then triethylamine (36 g, 355.77 mmol, 4.92 equiv) was added dropwise. The resulting solution was stirred for 2 hours at 25.degree. C. The resulting mixture was concentrated under vacuum. The resulting solution was diluted with 500 mL of ethyl acetate. The resulting mixture was washed with 3.times.500 mL of water. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1:10). This resulted in 14 g (55%) of tert-butyl (2S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carboxyla- te as light yellow oil. LCMS (method A, ESI): RT=2.05 min, m/z=350.2 [M+H].sup.+.

Step 3: Synthesis of tert-butyl (2S,4S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate and tert-butyl (2S,4R)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate

##STR01108##

The crude product was purified by Chrial-HPLC with the following conditions: Column name: CHIRALPAK AD-H, 4.6*150 mm, 5 um, Co-Solvent: EtOH (0.1% DEA), % Co-Solvent: Hexane, 25.000, Detector: 220 nm. The resulting solution was concentrated under vacuum. This resulted in 9.8 g (70%) of tert-butyl (2S,4S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate as white solid. .sup.1H-NMR (400 MHz, DMSO): .delta. 8.54-8.52 (m, 1H), 6.47 (s, 1H), 3.94-3.87 (m, 2H), 3.57-3.53 (m, 1H), 3.32-3.26 (m, 1H), 2.20-2.16 (m, 1H), 1.80-1.63 (m, 4H), 1.39 (s, 9H), 1.16-1.15 (m, 3H), 1.10-1.06 (m, 2H), 0.93-0.89 (m, 2H) ppm. And 3.3 g (24%) of tert-butyl (2S,4R)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate as a light yellow solid. .sup.1H-NMR (400 MHz, DMSO): .delta. 8.54-8.52 (m, 1H), 6.46 (s, 1H), 4.54-4.30 (m, 1H), 4.28-4.04 (m, 1H), 4.00-3.68 (m, 1H), 3.10-2.70 (m, 1H), 2.19-2.15 (m, 1H), 1.76-1.73 (m, 1H), 1.63-1.59 (m, 2H), 1.39-1.35 (m, 10H), 1.13-1.08 (m, 5H), 1.00-0.82 (m, 2H) ppm.

Step 4: Synthesis of 5-cyclopropyl-N-((2S,4S)-2-methylpiperidin-4-yl)isoxazole-3-carboxamide hydrochloride and 5-cyclopropyl-N-((2S,4R)-2-methylpiperidin-4-yl)isoxazole-3-carboxamide hydrochloride

##STR01109##

Into a 250-mL round-bottom flask was placed dichloromethane (100 mL), tert-butyl (2S,4S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate (9.8 g, 28.05 mmol, 1.00 equiv). To the above hydrogen chloride was introduced. The resulting solution was stirred for 2 hours at 25.degree. C. The resulting mixture was concentrated under vacuum. This resulted in 8.6 g of 5-cyclopropyl-N-[(2S,4S)-2-methylpiperidin-4-yl]-1,2-oxazole-3-c- arboxamide hydrochloride as a white solid. .sup.1HNMR (400 MHz, MeOD): .delta. 6.40 (s, 1H), 4.24-4.10 (m, 1H), 3.55-3.45 (m, 1H), 3.40-3.35 (m, 1H), 3.19-3.15 (m, 1H), 2.24-2.15 (m, 3H), 1.82-1.77 (m, 1H), 1.63-1.60 (m, 1H), 1.93-1.37 (m, 3H), 1.21-1.13 (m, 2H), 1.00-0.96 (m, 2H) ppm. LCMS (method A, ESI): RT=1.13 min, m/z=250.1 [M-HCl+H].sup.+.

##STR01110##

Into a 100-mL round-bottom flask was placed dichloromethane (50 mL), tert-butyl (2S,4R)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate (3.3 g, 9.44 mmol, 1.00 equiv). To the above hydrogen chloride was introduced. The resulting solution was stirred for 2 h at room temperature. The resulting mixture was concentrated under vacuum. This resulted in 3 g (crude) of 5-cyclopropyl-N-[(2S,4R)-2-methylpiperidin-4-yl]-1,2-oxazole-3-carboxamid- e hydrochloride as a light yellow solid. .sup.1H NMR (400 MHz, MeOD): .delta.6.41 (s, 1H), 4.36-4.34 (m, 1H), 3.62-3.59 (m, 1H), 3.40-3.35 (m, 2H), 2.21-2.03 (m, 4H), 1.90-1.82 (m, 1H), 1.39-1.37 (m, 3H), 1.18-1.14 (m, 2H), 1.00-0.96 (m, 2H) ppm. LCMS (method A, ESI): RT=1.03 min, m/z=250.1 [M-HCl+H].sup.+.

Example 3

Synthesis of 5-cyclopropyl-N-((2R,4R)-2-methylpiperidin-4-yl)isoxazole-3-carboxamide hydrochloride and 5-cyclopropyl-N-((2R,4S)-2-methylpiperidin-4-yl)isoxazole-3-carboxamide hydrochloride

##STR01111##

Step 1: Synthesis of (2R)-tert-butyl 4-amino-2-methylpiperidine-1-carboxylate

##STR01112##

Into a 5000-mL round-bottom flask was placed tert-butyl (2R)-2-methyl-4-oxopiperidine-1-carboxylate (8.53 g, 40.00 mmol, 1.00 equiv), HCOONH.sub.4 (100.8 g, 1.60 mol, 39.97 equiv), methanol (4 L) and acetic acid (2.4 g, 39.97 mmol, 1.00 equiv). Then NaBH.sub.3CN (5.04 g, 80.00 mmol, 2.00 equiv) was added batchwise. The resulting solution was stirred for 15 h at room temperature. The resulting mixture was concentrated under vacuum. The resulting solution was diluted with 200 mL of brine (sat.). The resulting solution was extracted with 3.times.100 mL of ethyl acetate and the organic layers combined. The resulting mixture was washed with 3.times.100 mL of brine and concentrated under vacuum. This resulted in 10.5 g (98%) of tert-butyl (2R)-4-amino-2-methylpiperidine-1-carboxylate as a white solid. LCMS (method A, ESI): RT=1.06 min, m/z=159.0 [M-56+H].sup.+. \

Step 2: Synthesis of (2R,4R)-tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-2-methylpiperidine-1-carboxylate and (2R,4S)-tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-2-methylpiperidine-1-carboxylate

##STR01113##

Into a 500-mL round-bottom flask was placed 5-cyclopropyl-1,2-oxazole-3-carboxylic acid (6.12 g, 39.96 mmol, 1.00 equiv), tert-butyl (2R)-4-amino-2-methylpiperidine-1-carboxylate (8.57 g, 39.99 mmol, 1.00 equiv), dichloromethane (300 g), TEA (12.12 g, 120.00 mmol, 3.00 equiv) and HATU (22.8 g, 60.00 mmol, 1.50 equiv). The resulting solution was stirred for 15 h at room temperature. The resulting mixture was then washed with 2.times.100 mL of Na.sub.2CO.sub.3 (1M, aq.). Then the organic phase was dried over Na.sub.2SO.sub.4 and concentrated under vacuum. The residue was purified by column chromatography (C18 gel, CH.sub.3CN/H.sub.2O=1:1) to give 10.8 g diastereomeric tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-2-methylpiperidine-1-carboxylate- . Then the purified product was separated by Prep-SFC with the following conditions (prep SFC 350): Column, CHIRALPAK AD-H SFC, 5.times.25 cm, 5 um; mobile phase, CO.sub.2(50%), methanol (50%); Detector, uv 220 nm. This was resulted in 7.48 g (54%) of tert-butyl (2R,4R)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate as light yellow oil. .sup.1H-NMR (300 MHz, CDCl.sub.3): 6.86 (d, J=6.9 Hz, 1H), 6.33 (s, 1H), 4.30-4.15 (m, 2H), 3.93-3.80 (m, 1H), 3.22-3.07 (m, 1H), 2.20-1.90 (m, 3H), 1.79-1.65 (m, 2H), 1.46 (s, 9H), 1.26 (d, J=6.9 Hz, 3H), 1.17-1.06 (m, 2H), 1.06-0.94 (m, 2H) ppm. LCMS (method A, ESI): RT=1.46 min, m/z=372.2 [M+H].sup.+. And 2.52 g (18%) of tert-butyl (2R,4S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate as a light yellow solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 6.55 (d, J=8.1 Hz, 1H), 6.33 (s, 1H), 4.63-4.39 (m, 1H), 4.39-4.15 (m, 1H), 4.15-3.95 (m, 1H), 3.0-2.85 (m, 1H), 2.15-1.98 (m, 2H), 1.92-1.78 (m, 1H), 1.65-1.50 (m, 1H), 1.46 (s, 9H), 1.42-1.26 (m, 1H), 1.23 (d, J=6.9 Hz, 3H), 1.17-1.06 (m, 2H), 1.06-0.94 (m, 2H) ppm. LCMS (method A, ESI): RT=1.46 min, m/z=372.2 [M+H].sup.+.

Step 3: Synthesis of 5-cyclopropyl-N-((2R,4R)-2-methylpiperidin-4-yl)isoxazole-3-carboxamide hydrochloride

##STR01114##

Into a 250-mL round-bottom flask was placed tert-butyl (2R,4R)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate (7.48 g, 21.41 mmol, 1.00 equiv) and 1,4-dioxane (50 mL). Then hydrogen chloride was introduced into mixture. The resulting solution was stirred for 15 h at room temperature. The resulting mixture was concentrated under vacuum. This resulted in 6.03 g (99%) of 5-cyclopropyl-N-[(2R,4R)-2-methylpiperidin-4-yl]-1,2-oxazole-3-carboxamid- e hydrochloride as a white solid. LCMS (method D, ESI): RT=0.58 min, m/z=250.0 [M+H].sup.+.

Step 4: Synthesis of 5-cyclopropyl-N-((2R,4S)-2-methylpiperidin-4-yl)isoxazole-3-carboxamide hydrochloride

##STR01115##

Into a 100-mL round-bottom flask was placed tert-butyl (2R,4S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate (2.52 g, 7.21 mmol, 1.00 equiv) and 1,4-dioxane (15 mL). Then hydrogen chloride was introduced into mixture. The resulting solution was stirred for 15 h at room temperature. The resulting mixture was concentrated under vacuum. This resulted in 2.0 g (97%) of 5-cyclopropyl-N-[(2R,4S)-2-methylpiperidin-4-yl]-1,2-oxazole-3-carboxamid- e hydrochloride as a light yellow solid. LCMS (method A, ESI): RT=1.12 min, m/z=250.0 [M+H].sup.+.

Example 4

Synthesis of N-((2S,4S)-2-benzylpiperidin-4-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride salt

##STR01116##

Step 1: Synthesis of tert-butyl 4-amino-2-benzylpiperidine-1-carboxylate

##STR01117##

Into a 5-L round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed tert-butyl 2-benzyl-4-oxopiperidine-1-carboxylate (5 g, 17.28 mmol, 1.00 equiv), methanol (4 L), acetic acid (2.076 g, 34.57 mmol, 2.00 equiv) and HCOONH.sub.4 (43.599 g). The resulting solution was stirred for 0.5 h at room temperature. Then NaBH.sub.3CN (2.180 g, 34.69 mmol, 2.01 equiv) was added by batchwise. The resulting solution was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. The resulting solution was diluted with 200 mL of EA. The resulting mixture was washed with 4.times.100 mL of brine (sat.). The organic phase was collected and concentrated under vacuum. The solid was dried in an oven under reduced pressure. This resulted in 5 g (100%) of tert-butyl 4-amino-2-benzylpiperidine-1-carboxylate as light yellow oil. LCMS (method C, ESI): RT=0.89 min, m/z=235.0 [M-56+H].sup.+.

Step 2: Synthesis of (2R,4R)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate

##STR01118##

(2S,4S)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate

##STR01119##

(2S,4R)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate

##STR01120## and

(2R,4S)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate

##STR01121##

Into a 250-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed tert-butyl 4-amino-2-benzylpiperidine-1-carboxylate (5 g, 17.22 mmol, 1.00 equiv), dichloromethane (100 mL), TEA (8.707 g, 86.05 mmol, 5.00 equiv), 5-cyclopropyl-1,2-oxazole-3-carboxylic acid (3.957 g, 25.84 mmol, 1.50 equiv), HATU (19.655 g, 51.69 mmol, 3.00 equiv). The resulting solution was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. The resulting solution was diluted with 200 mL of EA. The resulting mixture was washed with 3.times.200 mL of brine (sat.). The organic phase was collected and dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (1:10). The collected fractions were combined and concentrated under vacuum. The crude product 2.9 g was purified by Prep-SFC with the following conditions (prep SFC 350-2): Column, Chiralpak AD-H, 5.times.25 cm, Sum; mobile phase, CO.sub.2(70%), IPA (30%) and DCM/MeOH=1/3:100; Detector, uv 210 nm yielding two fractions: first peak--cis enantiomers 1.7 g, second peak trans enantiomers 0.6 g.

These products were further purified by SFC. The cis mixtures were purified by Prep-SFC with the following conditions (prep SFC 350-2): Column, Chiralpak AS-H, 5*25 cm, Sum; mobile phase, CO.sub.2 (70%), IPA (30%) and MeOH (50%); Detector, uv 210 nm. This resulted in 820 mg of (2R,4R)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate as yellow oil and 870 mg of (2S,4S)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate as yellow oil. (2R,4R)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate- : .sup.1H-NMR (300 MHz, CD.sub.3Cl) .delta.: 7.26-7.17 (m, 5H), 6.88 (d, J=6.9 Hz, 1H), 6.32 (d, J=0.6 Hz, 1H), 4.38-4.28 (m, 1H), 4.27-4.16 (m, 1H), 4.09-3.98 (m, 1H), 3.18-2.99 (m, 2H), 2.82-2.75 (m, 1H), 2.12-1.98 (m, 2H), 1.91-1.66 (m, 3H), 1.37 (d, J=2.7 Hz, 9H), 1.18-1.09 (m, 2H), 1.02-0.92 (m, 2H) ppm. LCMS (method A, ESI): RT=1.59 min, m/z=326.0 [M-Boc+H].sup.+. (2S,4S)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate- : .sup.1H-NMR (300 MHz, CD.sub.3Cl) .delta.: 7.26-7.17 (m, 5H), 6.88 (d, J=6.9 Hz, 1H), 6.32 (d, J=0.6 Hz, 1H), 4.38-4.28 (m, 1H), 4.27-4.16 (m, 1H), 4.09-3.98 (m, 1H), 3.18-2.99 (m, 2H), 2.82-2.75 (m, 1H), 2.12-1.98 (m, 2H), 1.91-1.66 (m, 3H), 1.37 (d, J=2.7 Hz, 9H), 1.18-1.09 (m, 2H), 1.02-0.92 (m, 2H) ppm. LCMS (method A, ESI): RT=1.59 min, m/z=326.0 [M-Boc+H].sup.+.

The trans mixture was purified by Prep-SFC with the following conditions (prep SFC 350): Column, Phenomenex Lux 5u Cellulose-4250*50 mm00G-4491-V0-AX664184-1; mobile phase, CO.sub.2(50%) and MeOH (50%), Detector, uv 220 nm. This resulted in 250 mg of (2S,4R)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate as yellow oil and 260 mg of (2R,4S)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate as yellow oil. (2S,4R)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate- : .sup.1H-NMR (300 MHz, CD.sub.3Cl) .delta.: 7.26-7.17 (m, 5H), 6.88 (d, J=6.9 Hz, 1H), 6.32 (s, 1H), 4.81-3.91 (m, 3H), 3.08 (t, J=13.5 Hz, 1H), 2.96-2.81 (m, 2H), 2.11-2.02 (m, 2H), 1.95 (d, J=10.5 Hz, 1H), 1.52-1.22 (m, 11H), 1.15-1.05 (m, 2H), 1.02-0.92 (m, 2H) ppm. LCMS (method A, ESI): RT=1.58 min, m/z=448.0 [M+Na].sup.+. (2R,4S)-tert-butyl 2-benzyl-4-(5-cyclopropylisoxazole-3-carboxamido)piperidine-1-carboxylate- : .sup.1H-NMR (300 MHz, CD.sub.3Cl) .delta.: 7.26-7.17 (m, 5H), 6.88 (d, J=6.9 Hz, 1H), 6.32 (s, 1H), 4.81-3.91 (m, 3H), 3.08 (t, J=13.5 Hz, 1H), 2.96-2.81 (m, 2H), 2.11-2.02 (m, 2H), 1.95 (d, J=10.5 Hz, 1H), 1.52-1.22 (m, 11H), 1.15-1.05 (m, 2H), 1.02-0.92 (m, 2H) ppm. LCMS (method A, ESI): RT=1.58 min, m/z=448.0 [M+Na].sup.+.

Step 3: Synthesis of N-((2R,4R)-2-benzylpiperidin-4-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride

##STR01122##

N-((2S,4S)-2-benzylpiperidin-4-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride

##STR01123##

N-((2S,4R)-2-benzylpiperidin-4-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride

##STR01124## and

N-((2R,4S)-2-benzylpiperidin-4-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride

##STR01125##

Into a 250-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed tert-butyl (2R,4R)-2-benzyl-4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidine-1-carbox- ylate (820 mg, 1.93 mmol, 1.00 equiv) and 1,4-dioxane (20 mL). Then hydrogen chloride was introduced into mixture. The resulting solution was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. This resulted in 670 mg (96%) of N-[(2R,4R)-2-benzylpiperidin-4-yl]-5-cyclopropyl-1,2-oxazole-3-carboxamid- e hydrochloride as a white solid. LCMS (method A, ESI): RT=1.11 min, m/z=326.0 [M+H].sup.+.

Into a 250-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed tert-butyl (2S,4S)-2-benzyl-4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidine-1-carbox- ylate (870 mg, 2.05 mmol, 1.00 equiv) and 1,4-dioxane (20 mL). Then hydrogen chloride was introduced into mixture. The resulting solution was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. This resulted in 710 mg (96%) of N-[(2S,4S)-2-benzylpiperidin-4-yl]-5-cyclopropyl-1,2-oxazole-3-carboxamid- e hydrochloride as a white solid. LCMS (method A, ESI): RT=1.10 min, m/z=326.0 [M+H].sup.+.

Into a 250-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed tert-butyl (2S,4R)-2-benzyl-4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidine-1-carbox- ylate (250 mg, 0.59 mmol, 1.00 equiv) and 1,4-dioxane (10 mL). Then hydrogen chloride was introduced into mixture. The resulting solution was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. This resulted in 190 mg (91%) of N-[(2S,4R)-2-benzylpiperidin-4-yl]-5-cyclopropyl-1,2-oxazole-3-carboxamid- e hydrochloride as a white solid. LCMS (method A, ESI): RT=1.11 min, m/z=326.0 [M+H].sup.+.

Into a 250-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed tert-butyl (2R,4S)-2-benzyl-4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidine-1-carbox- ylate (260 mg, 0.61 mmol, 1.00 equiv) and 1,4-dioxane (10 mL). Then hydrogen chloride was introduced into mixture. The resulting solution was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. This resulted in 200 mg (91%) of N-[(2R,4S)-2-benzylpiperidin-4-yl]-5-cyclopropyl-1,2-oxazole-3-carboxamid- e hydrochloride as a white solid. LCMS (method A, ESI): RT=1.11 min, m/z=326.0 [M+H].sup.+.

Example 5

Synthesis of N-((1R,3s,5S)-9-azabicyclo[3.3.1]nonan-3-yl)-5-cyclopropylisoxazole-3-car- boxamide

##STR01126## and

N-((1R,3r,5S)-9-azabicyclo[3.3.1]nonan-3-yl)-5-cyclopropylisoxazole-3-carb- oxamide

##STR01127##

Step 1: Synthesis of (1R,5S,E)-tert-butyl 3-(hydroxyimino)-9-azabicyclo[3.3.1]nonane-9-carboxylate

##STR01128##

Into a 2000-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed a solution of (1R,5S)-tert-butyl 3-oxo-9-azabicyclo[3.3.1]nonane-9-carboxylate (25 g, 104.03 mmol, 1.00 equiv) in ethanol (500 mL) at room temperature. This was followed by the addition of hydroxylamine hydrochloride (14.5 g, 208.66 mmol, 2.01 equiv) at room temperature. To this was added a solution of sodium hydroxide (8.4 g, 210.00 mmol, 2.02 equiv) in water (250 mL) by dropwise with stirring at room temperature. The resulting solution was stirred for 8 h at 95.degree. C. The resulting mixture was concentrated under vacuum. The resulting solution was diluted with 250 mL of H.sub.2O. The resulting solution was extracted with 3.times.250 mL of dichloromethane and the organic layers combined. The resulting solution was concentrated under vacuum. This resulted in 26 g (98%) of (1R,5S,E)-tert-butyl 3-(hydroxyimino)-9-azabicyclo[3.3.1]nonane-9-carboxylate as a white solid. .sup.1H NMR (300 MHz, DMSO) .delta.: 10.40 (s, 1H), 4.29 (s, 2H), 3.04 (d, 1H), 2.44-2.27 (m, 2H), 1.99 (d, 1H), 1.79-1.58 (m, 5H), 1.49-1.45 (m, 1H), 1.41 (s, 9H) ppm. LCMS (Method D, ESI): RT=1.76 min, m/z=240.0 [M-15+H].sup.+.

Step 2: Synthesis of (1R,3s,5S)-tert-butyl 3-amino-9-azabicyclo[3.3.1]nonane-9-carboxylate and (1R,3r,5S)-tert-butyl 3-amino-9-azabicyclo[3.3.1]nonane-9-carboxylate

##STR01129##

Into a 5000-mL round-bottom flask was placed a solution of (1R,5S,E)-tert-butyl 3-(hydroxyimino)-9-azabicyclo[3.3.1]nonane-9-carboxylate (26 g, 101.83 mmol, 1.00 equiv) in methanol (4500 mL) at room temperature. This was followed by the addition of Raney-Ni (13 g) at room temperature. The flask was evacuated and flushed three times with nitrogen, then followed by flushing with hydrogen. The mixture was stirred 7 h at room temperature under an atmosphere of hydrogen (maintained with 2 atm pressure). The solids were filtered out. The resulting mixture was concentrated under vacuum. This resulted in 21.2 g (86%) of (1R,3s,5S)-tert-butyl 3-amino-9-azabicyclo[3.3.1]nonane-9-carboxylate and (1R,3r,5S)-tert-butyl 3-amino-9-azabicyclo[3.3.1]nonane-9-carboxylate as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) .delta.: 4.55-4.21 (m, 2H), 3.66-3.58 (m, 0.27H), 2.73-2.62 (m, 0.73H), 2.31-2.18 (m, 1H), 2.01-1.89 (m, 1H), 1.89-1.75 (m, 3H), 1.70-1.52 (m, 3H), 1.52-1.49 (m, 1H), 1.46 (s, 9H), 1.45-1.35 (m, 1.5H), 1.21-1.09 (m, 1.5H) ppm. LCMS (Method D, ESI): RT=1.28 min, m/z=282.0 [M+H+CH.sub.3CN].sup.+.

Step 3: Synthesis of (1R,3s,5S)-tert-butyl 3-(5-cyclopropylisoxazole-3-carboxamido)-9-azabicyclo[3.3.1]nonane-9-carb- oxylate and (1R,3r,5S)-tert-butyl 3-(5-cyclopropylisoxazole-3-carboxamido)-9-azabicyclo[3.3.1]nonane-9-carb- oxylate

##STR01130##

Into a 1000-mL round-bottom flask was placed (1R,3s,5S)-tert-butyl 3-amino-9-azabicyclo[3.3.1]nonane-9-carboxylate and (1R,3r,5S)-tert-butyl 3-amino-9-azabicyclo[3.3.1]nonane-9-carboxylate (20.5 g, 84.94 mmol, 1.00 equiv), dichloromethane (410 mL), 5-cyclopropyl-1,2-oxazole-3-carboxylic acid (19.6 g, 127.99 mmol, 1.51 equiv), EDCI (32.6 g, 170.06 mmol, 2.00 equiv), HOBT (17.3 g, 128.03 mmol, 1.51 equiv), TEA (43.1 g, 425.93 mmol, 5.01 equiv). The resulting solution was stirred for 3 h at room temperature. The resulting solution was diluted with 400 mL of DCM. The resulting mixture was washed with 2.times.400 mL of H.sub.2O. The residue was purified on a silica gel column with dichloromethane/methanol (20:1). This resulted in 30.3 g (95%) of (1R,3s,5S)-tert-butyl 3-(5-cyclopropylisoxazole-3-carboxamido)-9-azabicyclo[3.3.1]nonane-9-carb- oxylate and (1R,3r,5S)-tert-butyl 3-(5-cyclopropylisoxazole-3-carboxamido)-9-azabicyclo[3.3.1]nonane-9-carb- oxylate as a white solid. .sup.1H NMR (300 MHz, CD.sub.3OD) .delta.: 6.40 (d, 1H), 5.01-4.90 (m, 0.33H), 4.55-4.29 (m, 2H), 3.92-3.78 (m, 0.67H), 2.37-2.21 (m, 1.4H), 2.21-1.99 (m, 2.6H), 1.95-1.70 (m, 2H), 1.68-1.54 (m, 5H), 1.50 (s, 9H), 1.20-1.10 (m, 2H), 1.01-0.91 (m, 2H) ppm. LCMS (Method D, ESI): RT=2.22 min, m/z=361.0 [M-15+H].sup.+.

Step 4: Synthesis of (1R,3s,5S)-tert-butyl 3-(5-cyclopropylisoxazole-3-carboxamido)-9-azabicyclo[3.3.1]nonane-9-carb- oxylate and (1R,3r,5S)-tert-butyl 3-(5-cyclopropylisoxazole-3-carboxamido)-9-azabicyclo[3.3.1]nonane-9-carb- oxylate

##STR01131##

The mixture of diastereomers (30 g) was purified by prep-SFC with the following conditions: Column: Phenomenex Lux 5u Cellulose-35*25 cm, 5 um Chiral-P(Lux-3)001608862-1; Detector: UV 220 nm; Mobile Phase: CO.sub.2(70%), MeOH (30%). The resulting solution was concentrated under vacuum. This resulted in 20.6 g (95%) of (1R,3r,5S)-tert-butyl 3-(5-cyclopropylisoxazole-3-carboxamido)-9-azabicyclo[3.3.1]nonane-9-carb- oxylate as a white solid. .sup.1H NMR (300 MHz, CD.sub.3OD) .delta.: 6.35 (s, 1H), 4.47 (d, 2H), 3.90-3.75 (m, 1H), 2.35-2.23 (m, 2H), 2.21-2.02 (m, 2H), 1.69-1.52 (m, 7H), 1.50 (s, 9H), 1.18-1.10 (m, 2H), 0.98-0.90 (m, 2H) ppm. LCMS (Method D, ESI): RT=2.20 min, m/z=320.0 [M-56+H].sup.+. And 8.0 g (86%) of (1R,3s,5S)-tert-butyl 3-(5-cyclopropylisoxazole-3-carboxamido)-9-azabicyclo[3.3.1]nonane-9-carb- oxylate as a white solid. .sup.1H NMR (300 MHz, CD.sub.3OD) .delta.: 6.36 (s, 1H), 5.02-4.91 (m, 1H), 4.34 (s, 2H), 2.22-2.10 (m, 1H), 2.09-1.97 (m, 3H), 1.93-1.64 (m, 7H), 1.48 (s, 9H), 1.18-1.10 (m, 2H), 0.98-0.90 (m, 2H) ppm. LCMS (Method D, ESI): RT=2.19 min, m/z=320.0 [M-56+H].sup.+.

Step 5: Synthesis of N-((1R,3r,5S)-9-azabicyclo[3.3.1]nonan-3-yl)-5-cyclopropylisoxazole-3-car- boxamide

##STR01132##

Into a 250-mL round-bottom flask was placed (1R,3r,5S)-tert-butyl 3-(5-cyclopropylisoxazole-3-carboxamido)-9-azabicyclo[3.3.1]nonane-9-carb- oxylate (20.6 g, 54.72 mmol, 1.00 equiv) and dichloromethane (150 mL). To the above hydrogen chloride was introduced. The resulting solution was stirred for 2 h at room temperature. The resulting solution was diluted with 400 mL of H.sub.2O. The pH value of the solution was adjusted to 9 with potassium carbonate. The resulting solution was extracted with 3.times.250 mL of dichloromethane and the organic layers combined and concentrated under vacuum. This resulted in 14.2 g (94%) of N-((1R,3r,5S)-9-azabicyclo[3.3.1]nonan-3-yl)-5-cyclopropylisoxazole-3-car- boxamide as a white solid. .sup.1H NMR (400 MHz, CD.sub.3OD) .delta.: 6.38 (s, 1H), 4.29-4.20 (m, 1H), 3.36 (d, 2H), 2.28-2.11 (m, 3H), 2.10-2.00 (m, 1H), 1.79-1.69 (m, 2H), 1.58-1.37 (m, 5H), 1.19-1.11 (m, 2H), 0.98-0.92 (m, 2H) ppm. LCMS (Method D, ESI): RT=1.23 min, m/z=317.0 [M+H+CH.sub.3CN].sup.+.

Step 6: Synthesis of N-((1R,3s,5S)-9-azabicyclo[3.3.1]nonan-3-yl)-5-cyclopropylisoxazole-3-car- boxamide

##STR01133##

Into a 250-mL round-bottom flask was placed (1R,3s,5S)-tert-butyl 3-(5-cyclopropylisoxazole-3-carboxamido)-9-azabicyclo[3.3.1]nonane-9-carb- oxylate (8.0 g, 21.25 mmol, 1.00 equiv), dichloromethane (100 mL). To the above hydrogen chloride was introduced. The resulting solution was stirred for 2 h at room temperature. The resulting solution was diluted with 300 mL of H.sub.2O. The pH value of the solution was adjusted to 9 with potassium carbonate. The resulting solution was extracted with 3.times.100 mL of dichloromethane and the organic layers combined and concentrated under vacuum. This resulted in 5.5 g (94%) of N-((1R,3s,5S)-9-azabicyclo[3.3.1]nonan-3-yl)-5-cyclopropylisoxazole-3-car- boxamide as a white solid. .sup.1H NMR (400 MHz, CD.sub.3OD) .delta.: 6.38 (s, 1H), 4.89-4.80 (m, 1H), 3.22 (s, 2H), 2.21-2.13 (m, 1H), 2.09-1.88 (m, 5H), 1.85-1.70 (m, 5H), 1.19-1.11 (m, 2H), 0.98-0.92 (m, 2H) ppm. LCMS (Method D, ESI): RT=1.20 min, m/z=276.0 [M+H].sup.+.

Example 6

Synthesis of N-((1R,3r,5S)-8-aza-bicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-ca- rboxamide hydrochloride

##STR01134## and

N-((1R,3s,5S)-8-aza-bicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-car- boxamide hydrochloride

##STR01135##

Step 1: Synthesis of tert-butyl 3-amino-8-azabicyclo[3.2.1]octane-8-carboxylate

##STR01136##

Into a 2000-mL 3-necked round-bottom flask was placed HCOONH.sub.4 (42 g, 666.03 mmol, 30.00 equiv), acetic acid (1.3 g, 21.65 mmol, 1.00 equiv) and methanol (1.5 L). Then NaBH.sub.3CN (2.8 g, 44.56 mmol, 2.00 equiv) was added into batch wise. This was followed by the addition of a solution of tert-butyl 3-oxo-8-azabicyclo[3.2.1]octane-8-carboxylate (5 g, 22.19 mmol, 1.00 equiv) in methanol (100 mL) dropwise with stirring at 25.degree. C. The resulting solution was stirred for 12 h at 25.degree. C. The resulting mixture was concentrated under vacuum. The resulting solution was diluted with 200 mL of H.sub.2O. The resulting solution was extracted with 3.times.200 mL of ethyl acetate and the organic layers combined. The resulting mixture was washed with 1.times.200 mL of brine (sat.). The mixture was dried over anhydrous sodium sulfate. The residue was applied onto a silica gel column with dichloromethane/methanol (9:1). This resulted in 4.8 g (90%) of tert-butyl 3-amino-8-azabicyclo[3.2.1]octane-8-carboxylate as colorless oil. LCMS (method D, ESI): RT=0.97 min, m/z=227.0 [M+H].sup.+.

Step 2: Synthesis of tert-butyl (1R,3r,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]octan- e-8-carboxylate and tert-butyl (1R,3s,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]octan- e-8-carboxylate

##STR01137##

Into a 250-mL round-bottom flask was placed tert-butyl 3-amino-8-azabicyclo[3.2.1]octane-8-carboxylate (4 g, 17.67 mmol, 1.00 equiv), 5-cyclopropyl-1,2-oxazole-3-carboxylic acid (2.7 g, 17.63 mmol, 1.00 equiv), HATU (10 g, 26.30 mmol, 1.50 equiv), DIEA (5.7 g, 44.10 mmol, 2.50 equiv), DMF (100 mL). The resulting solution was stirred for 12 h at 25.degree. C. The reaction was then quenched by the addition of 100 mL of water. The resulting solution was extracted with 3.times.100 mL of ethyl acetate and the organic layers combined. The resulting mixture was washed with 1.times.100 mL of brine. The mixture was dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1:4). The product (4.0 g) was further purified by Prep-SFC with the following conditions (prep SFC 350): Column, Phenomenex Lux 5u Cellulose-3, 5*25 cm, Sum; mobile phase, CO.sub.2(80%), methanol (20%); Detector, UV220 nm. This resulted in 800 mg (13%) of tert-butyl (1R,3s,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]octan- e-8-carboxylate as a yellow solid. .sup.1H NMR (400 MHz, CDCl.sub.3) .delta.: 6.53 (d, J=8.0 Hz, 1H), 6.33 (s, 1H), 4.41-4.58 (m, 1H), 4.24-4.32 (m, 2H), 1.95-2.11 (m, 5H), 1.80-1.84 (m, 2H), 1.57-1.63 (m, 2H), 1.50 (s, 9H), 1.16-1.28 (m, 2H), 0.95-1.06 (m, 2H) ppm. LCMS (method D, ESI): RT=2.33 min, m/z=362.0 [M+H].sup.+ and 1.4 g (22%) of tert-butyl (1R,3r,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]octan- e-8-carboxylate as a yellow solid. .sup.1H NMR (400 MHz, CDCl.sub.3) .delta.: 7.21-7.23 (d, J=7.6 Hz, 1H), 6.34 (s, 1H), 4.27-4.33 (m, 3H), 2.25-2.31 (m, 2H), 2.07-2.14 (m, 3H), 1.91-1.95 (m, 2H), 1.76-1.80 (m, 2H), 1.49 (s, 9H), 1.16-1.28 (m, 2H), 0.95-1.06 (m, 2H) ppm. LCMS (method D, ESI): RT=2.43 min, m/z=362.0 [M+H].sup.+.

Step 3: Synthesis of N-((1R,3r,5S)-8-aza-bicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-ca- rboxamide hydrochloride and N-((1R,3s,5S)-8-aza-bicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-ca- rboxamide hydrochloride

##STR01138##

Into two 50-mL round-bottom flasks was separately placed tert-butyl (1R,3r,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]octan- e-8-carboxylate (600 mg, 1.66 mmol, 1.00 equiv) and tert-butyl (1R,3s,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]octan- e-8-carboxylate (600 mg, 1.66 mmol, 1.00 equiv). This was followed by the addition of 10 mL of 1,4-dioxane into each flask. Then hydrogen chloride was introduced into the two mixtures. The resulting solutions were stirred for 2 h at 25.degree. C. The resulting mixtures were concentrated under vacuum. This resulted in 480 mg (97%) of N-((1R,3r,5S)-8-aza-bicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-ca- rboxamide hydrochloride LCMS (method D, ESI): RT=0.97 min, m/z=262.0 [M+H].sup.+ and 480 mg (97%) of N-((1R,3s,5S)-8-aza-bicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-ca- rboxamide hydrochloride as a light yellow solid. LCMS (method D, ESI): RT=0.95 min, m/z=262.0 [M+H].sup.+.

Example 7

Synthesis of N-[1-[(2S)-3-amino-2-[[4-hydroxy-3-(propan-2-yl)phenyl]methyl] propanoyl]piperidin-4-yl]-5-cyclopropyl-1,2-oxazole-3-carboxamide hydrochloride salt (Cpd. No. 121)

##STR01139##

Step 1: Synthesis of ethyl (2E)-2-cyano-3-(4-hydroxyphenyl)prop-2-enoate

##STR01140##

Into a 500-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed 4-hydroxybenzaldehyde (6 g, 49.13 mmol, 1.00 equiv) and ethanol (200 mL). Then ethyl 2-cyanoacetate (6.7 g, 59.23 mmol, 1.21 equiv) and piperidine (2 mL) was added. The resulting solution was stirred overnight at 90.degree. C. The resulting mixture was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1:2). This resulted in 8.5 g (80%) of ethyl (2E)-2-cyano-3-(4-hydroxyphenyl)prop-2-enoate as a yellow solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 8.19 (s, 1H), 7.97 (d, J=8.7 Hz, 2H), 6.99 (d, J=8.7 Hz, 2H), 6.11 (brs, 1H), 4.41-4.31 (m, 2H), 1.40 (t, J=7.2 Hz, 3H) ppm. LCMS (method A, ESI): RT=1.34 min, m/z=217.9 [M+H].sup.+.

Step 2: Synthesis of ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[(4-hydroxyphenyl)methyl] propanoate

##STR01141##

Into a 500-mL round-bottom flask was placed ethyl (2E)-2-cyano-3-(4-hydroxyphenyl)prop-2-enoate (8.5 g, 39.13 mmol, 1.00 equiv), methanol (200 mL) and di-tert-butyl dicarbonate (9.4 g, 43.07 mmol, 1.10 equiv). Then Raney-Ni (3 g) was added batchwise. Then H.sub.2 was introduced into mixture and maintained at 2 atm pressure. The resulting solution was stirred overnight at room temperature. The solids were filtered out. The resulting mixture was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1:3). This resulted in 12 g (95%) of ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[(4-hydroxyphenyl)methyl]propanoate as a light yellow solid. LCMS (method C, ESI): RT=0.95 min, m/z=324.2 [M+H].sup.+.

Step 3: Synthesis of ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[(4-hydroxy-3-iodophenyl)methyl]propan- oate

##STR01142##

Into a 250-mL round-bottom flask was placed ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[(4-hydroxyphenyl)methyl]propanoate (5 g, 15.46 mmol, 1.00 equiv), TsOH (266 mg, 1.54 mmol, 0.10 equiv) and dichloromethane (80 mL). Then NIS (3.48 g, 15.47 mmol, 1.00 equiv) was added into at room temperature. The resulting solution was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1:3). This resulted in 4.2 g (60%) of ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[(4-hydroxy-3-iodophenyl)methyl]propan- oate as a light yellow solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 7.46 (d, J=2.1 Hz, 1H), 7.06-7.02 (m, 1H), 6.89 (d, J=9.6 Hz, 1H), 4.15-4.07 (m, 2H), 3.32-3.24 (m, 2H), 2.84-2.72 (m, 3H), 1.43 (s, 9H), 1.19 (t, J=6.9 Hz, 3H) ppm. LCMS (method A, ESI): RT=1.70 min, m/z=349.9 [M-Boc+H].sup.+.

Step 4: Synthesis of ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[[4-hydroxy-3-(prop-1-en-2-yl)phenyl]m- ethyl]propanoate

##STR01143##

Into a 250-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[(4-hydroxy-3-iodophenyl)methyl]propan- oate (4 g, 8.90 mmol, 1.00 equiv), 4,4,5,5-tetramethyl-2-(prop-1-en-2-yl)-1,3,2-dioxaborolane (1.8 g, 10.71 mmol, 1.20 equiv), Pd(dppf)Cl.sub.2 (650 mg), Cs.sub.2CO.sub.3 (8.7 g, 26.62 mmol, 2.99 equiv), and N,N-dimethylformamide (50 mL). The resulting solution was stirred overnight at 100.degree. C. The resulting solution was diluted with 40 mL of NH.sub.4Cl (sat. aq.). The resulting solution was extracted with 4.times.40 mL of ethyl acetate and the organic layers combined. The resulting mixture was washed with 4.times.50 mL of NH.sub.4Cl (sat. aq.). The resulting mixture was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1:5). This resulted in 1 g (31%) of ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[[4-hydroxy-3-(prop-1-en-2-yl)phenyl]m- ethyl]propanoate as light brown oil. LCMS (method A, ESI): RT=1.74 min, m/z=264.0 [M-Boc+H].sup.+.

Step 5: Synthesis of ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[[4-hydroxy-3-(propan-yl)phenyl]methyl- ]propanoate

##STR01144##

Into a 250-mL round-bottom flask, was placed ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[[4-hydroxy-3-(prop-1-en-2-yl)phenyl]m- ethyl]propanoate (1.3 g, 3.58 mmol, 1.00 equiv), ethyl acetate (40 mL) and 10% Palladium carbon (0.7 g). Then H.sub.2 was introduced into mixture and maintained at 2 atm pressure. The resulting solution was stirred overnight at room temperature. The solids were filtered out. The resulting mixture was concentrated under vacuum. This resulted in 1.0 g (76%) of ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[[4-hydroxy-3-(propan-2-yl)phenyl]meth- yl]propanoate as light yellow oil. LCMS (method D, ESI): RT=1.57 min, m/z=366.0 [M+H].sup.+.

Step 6: Synthesis of 3-[[(tert-butoxy)carbonyl]amino]-2-[[4-hydroxy-3-(propan-2-yl)phenyl]meth- yl]propanoic acid

##STR01145##

Into a 250-mL round-bottom flask was placed ethyl 3-[[(tert-butoxy)carbonyl]amino]-2-[[4-hydroxy-3-(propan-2-yl)phenyl]meth- yl]propanoate (1 g, 2.74 mmol, 1.00 equiv), ethanol (40 mL), water (0.5 mL), sodium hydroxide (0.45 g). The resulting solution was stirred for 6 h at room temperature. The resulting mixture was concentrated under vacuum. The pH value of the solution was adjusted to 4 with hydrochloric acid (12N). The resulting solution was extracted with 5.times.30 mL of ethyl acetate and the organic layers combined and concentrated under vacuum. This resulted in 0.6 g (65%) of 3-[[(tert-butoxy)carbonyl]amino]-2-[[4-hydroxy-3-(propan-2-yl)phenyl]meth- yl]propanoic acid as colorless oil. LCMS (method A, ESI): RT=1.56 min, m/z=360.1 [M+Na].sup.+.

Step 7: Synthesis of tert-butyl N-[3-[4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidin-1-yl]-2-[[4-hydroxy-- 3-(propan-2-yl)phenyl]methyl]-3-oxopropyl]carbamate

##STR01146##

Into a 250-mL round-bottom flask was placed 3-[[(tert-butoxy)carbonyl]amino]-2-[[4-hydroxy-3-(propan-2-yl)phenyl]meth- yl]propanoic acid (600 mg, 1.78 mmol, 1.00 equiv), 5-cyclopropyl-N-(piperidin-4-yl)-1,2-oxazole-3-carboxamide hydrochloride (750 mg, 2.76 mmol, 1.55 equiv), EDCI (0.85 g), HOBT (0.6 g) and dichloromethane (60 mL). Then TEA (0.9 g) was added into dropwise at 0.degree. C. The resulting solution was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1:10). The product was further purified by Prep-HPLC with the following conditions (2#-Waters 2767-2(HPLC-08)): Column, Xbridge Prep Phenyl, 5 um, 19.times.150 mm; mobile phase, Water with 50 mmol ammonium bicarbonate and acetonitrile (10.0% acetonitrile up to 33.0% in 2 min, up to 53.0% in 8 min, up to 100.0% in 1 min, down to 10.0% in 1 min); Detector, UV 254 nm. This resulted in 650 mg (66%) of tert-butyl N-[3-[4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidin-1-yl]-2-[[4-hydroxy-- 3-(propan-2-yl)phenyl]methyl]-3-oxopropyl]carbamate as a white solid. LCMS (method A, ESI): RT=1.69 min, m/z=455.2 [M-Boc+H].sup.+.

Step 8: Synthesis of tert-butyl N-[(2S)-3-[4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidin-1-yl]-2-[[4-hyd- roxy-3-(propan-2-yl)phenyl]methyl]-3-oxopropyl]carbamate

##STR01147##

The tert-butyl N-[3-[4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidin-1-yl]-2-[[4-hydroxy-- 3-(propan-2-yl)phenyl]methyl]-3-oxopropyl]carbamate (600 mg, 1.08 mmol, 1.00 equiv) was separated by Chiral-HPLC with following conditions: (Chiral-p(Lux-4)003667995-2): Column, Phenomenex Lux 5u Cellulose-4, AXIA Packed 250*21.2 mm, 5 um, mobile phase, Phase A: Hex-HPLC and Phase B: EtOH-HPLC Gradient; Detector, uv 254/220 nm. This resulted in 256 mg (43%) of tert-butyl N-[(2S)-3-[4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidin-1-yl]-2-[[4-hyd- roxy-3-(propan-2-yl)phenyl]methyl]-3-oxopropyl]carbamate as a white solid. LCMS (method A, ESI): RT=1.68 min, m/z=455.3 [M-Boc+H].sup.+.

Step 9: Synthesis of N-[1-[(2S)-3-Amino-2-[[4-hydroxy-3-(propan-2-yl)phenyl]methyl] propanoyl]piperidin-4-yl]-5-cyclopropyl-1,2-oxazole-3-carboxamide hydrochloride salt

##STR01148##

Into a 100-mL round-bottom flask was placed tert-butyl N-[(2S)-3-[4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidin-1-yl]-2-[[4-hyd- roxy-3-(propan-2-yl)phenyl]methyl]-3-oxopropyl]carbamate (256 mg, 0.46 mmol, 1.00 equiv) and dichloromethane (20 mL). Then hydrogen chloride was introduced into mixture. The resulting solution was stirred for 4 h at room temperature. The solids were collected by filtration. The resulting filtrate was concentrated under vacuum. This resulted in 152.2 mg (67%) of N-[1-[(2S)-3-amino-2-[[4-hydroxy-3-(propan-2-yl)phenyl]methyl]propanoy- l]piperidin-4-yl]-5-cyclopropyl-1,2-oxazole-3-carboxamide hydrochloride as a white solid. .sup.1H-NMR (300 MHz, CD.sub.3OD): .delta. 6.99 (dd, J=20.4 and 2.1 Hz, 1H), 6.86-6.81 (m, 1H), 6.73-6.69 (m, 1H), 6.36 (d, J=0.6 Hz, 1H), 4.60-4.37 (m, 1H), 4.05-3.88 (m, 1H), 3.87-3.63 (m, 1H), 3.50-3.36 (m, 1H), 3.30-2.98 (m, 3.5H), 2.88-2.72 (m, 3H), 2.62-2.45 (m, 0.5H), 2.21-2.11 (m, 1H), 1.96-1.62 (m, 2H), 1.62-1.42 (m, 1H), 1.40-1.24 (m, 0.5H), 1.23-1.18 (m, 6H), 1.18-1.09 (m, 2H), 1.02-0.90 (m, 2H), 0.78-0.60 (m, 0.5H) ppm. LCMS (method D, ESI): RT=1.96 min, m/z=455.1 [M+H].sup.+. ee=100%.

Example 8

Synthesis of N-((2R,4S,5R)-1-((1r,4R)-4-aminocyclohexanecarbonyl)-2,5-dimethylpiperidi- n-4-yl)-5-cyclopropylisoxazole-3-carboxamide (Cpd. No. 420)

##STR01149##

Step 1: Synthesis of tert-butyl 2,5-dimethylpyridin-4-ylcarbamate

##STR01150##

Into a 100-mL 3-necked round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed a solution of 2,5-dimethylpyridin-4-amine (488 mg, 3.99 mmol, 1.00 equiv) in tetrahydrofuran (10 mL), di-tert-butyl dicarbonate (959.2 mg, 4.40 mmol, 1.10 equiv). This was followed by the addition of LiHMDS ((7.98 mL, 7.98 mmol, 2.00 equiv, 1M in THF solution) dropwise with stirring at 0.degree. C. The resulting solution was stirred at 25.degree. C. overnight. The reaction was then quenched by the addition of 50 mL of NH.sub.4Cl (sat. aq.). The resulting solution was extracted with 3.times.20 mL of dichloromethane and the organic layers combined and dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was purified on a silica gel column with dichloromethane/methanol (100:1). This resulted in 740 mg (83%) of tert-butyl 2,5-dimethylpyridin-4-ylcarbamate as yellow oil. LCMS (method C, ESI): RT=0.83 min, m/z=223.0 [M+H].sup.+.

Step 2: Synthesis of tert-butyl 2,5-dimethylpiperidin-4-ylcarbamate

##STR01151##

Into a 30-mL high pressure tank reactor (70 atm), was placed a solution of tert-butyl N-(2,5-dimethylpyridin-4-yl)carbamate (1.11 g, 4.99 mmol, 1.00 equiv) in ethanol (25 mL), and 5% Rh/Al.sub.2O.sub.3. Then hydrogen was introduced into mixture and maintained at 70 atm. The resulting solution was stirred for 2 days at 70.degree. C. The reaction mixture was cooled to 25.degree. C. The solids were filtered out. The resulting mixture was concentrated under vacuum. This resulted in 440 mg of tert-butyl 2,5-dimethylpiperidin-4-ylcarbamate as black oil. LCMS (method A, ESI): RT=1.12 min, m/z=229.0 [M+H].sup.+.

Step 3: Synthesis of tert-butyl 1-((1R,4R)-4-(1,3-dioxoisoindolin-2-yl)cyclohexanecarbonyl)-2,5-dimethylp- iperidin-4-ylcarbamate

##STR01152##

Into a 25-mL round-bottom flask was placed tert-butyl N-(2,5-dimethylpiperidin-4-yl)carbamate (183.7 mg, 0.80 mmol, 1.10 equiv), (1R,4R)-4-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)cyclohexane-1-c- arboxylic acid (200 mg, 0.73 mmol, 1.00 equiv), HATU (334 mg, 0.88 mmol, 1.20 equiv). This was followed by the addition of TEA (370 mg, 3.66 mmol, 5.00 equiv) by dropwise with stirring. The resulting solution was stirred for 16 hours at 25.degree. C. The resulting solution was diluted with 100 mL of dichloromethane. The resulting mixture was washed with 3.times.30 mL of brine (sat. aq.). The mixture was dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was purified on a silica gel column with dichloromethane/methanol (100:1). This resulted in 700 mg of tert-butyl 1-((1R,4R)-4-(1,3-dioxoisoindolin-2-yl)cyclohexanecarbonyl)-2,5-dimethylp- iperidin-4-ylcarbamate as yellow oil. LCMS (method D, ESI): RT=0.91 min, m/z=484.0 [M+H].sup.+.

Step 4: Synthesis of 2-((1R,4R)-4-(4-Amino-2,5-dimethylpiperidine-1-carbonyl)cyclohexyl) isoindoline-1,3-dione hydrochloride

##STR01153##

Into a 100-mL round-bottom flask was placed a solution of tert-butyl N-(2,5-dimethyl-1-[ [(1R,4R)-4-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)cyclohexyl]carbonyl]pi- peridin-4-yl)carbamate (700 mg, 1.45 mmol, 1.00 equiv) in dichloromethane (30 mL). To the above hydrogen chloride was introduced. The resulting solution was stirred for 30 min at 25.degree. C. The resulting mixture was concentrated under vacuum. This resulted in 490 mg of 2-((1R,4R)-4-(4-amino-2,5-dimethylpiperidine-1-carbonyl)cyclohexyl)isoind- oline-1,3-dione hydrochloride as yellow oil. LCMS (method C, ESI): RT=1.11 min, m/z=384.0[M+H].sup.+.

Step 5: Synthesis of 5-Cyclopropyl-N-(1-((1R,4R)-4-(1,3-dioxoisoindolin-2-yl)cyclohexanecarbon- yl)-2,5-dimethylpiperidin-4-yl)isoxazole-3-carboxamide

##STR01154##

Into a 100-mL round-bottom flask was placed 2-[(1R,4R)-4-[(4-amino-2,5-dimethylpiperidin-1-yl)carbonyl]cyclohexyl]-2,- 3-dihydro-1H-isoindole-1,3-dione (838 mg, 2.19 mmol, 1.10 equiv), 5-cyclopropyl-1,2-oxazole-3-carboxylic acid (306 mg, 2.00 mmol, 1.00 equiv), HATU (912 mg, 2.40 mmol, 1.20 equiv). This was followed by the addition of triethylamine (1 g, 9.88 mmol, 5.00 equiv) dropwise with stirring. The resulting solution was stirred at 25.degree. C. overnight. The resulting solution was diluted with 100 mL of dichloromethane. The resulting mixture was washed with 3.times.30 mL of brine (sat.). The mixture was dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was purified on a silica gel column with dichloromethane/methanol (100:1). This resulted in 500 mg of 5-cyclopropyl-N-(2,5-dimethyl-1-[ [(1R,4R)-4-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)cyclohexyl]carbonyl]pi- peridin-4-yl)-1,2-oxazole-3-carboxamide as yellow oil. LCMS (method C, ESI): RT=0.99 min, m/z=519.0[M+H].sup.+

Step 6: Synthesis of N-(1-((1R,4R)-4-Aminocyclohexanecarbonyl)-2,5-dimethylpiperidin-4-yl)-5-c- yclopropylisoxazole-3-carboxamide

##STR01155##

Into a 100-mL round-bottom flask was placed 5-cyclopropyl-N-(2,5-dimethyl-1-[[(1R,4R)-4-(1,3-dioxo-2,3-dihydro-1H-iso- indol-2-yl)cyclohexyl]carbonyl]piperidin-4-yl)-1,2-oxazole-3-carboxamide (518 mg, 1.00 mmol, 1.00 equiv), water (1 mL) and propan-2-ol (6 mL). Then NaBH.sub.4 (380 mg, 10.05 mmol, 10.00 equiv) was added batchwise. The resulting solution was stirred for 16 hours at 25.degree. C. This was followed by the addition of acetic acid (0.2 mL, 0.10 equiv) dropwise with stirring. The resulting solution was allowed to react with stirring for 2 hour while the temperature was maintained at 80.degree. C. in an oil bath. Then the reaction system was cooled. The pH value of the solution was adjusted to 8 with sodium carbonate (50%, aq.). The resulting solution was extracted with 3.times.15 mL of dichloromethane and the organic layers combined and dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was purified on a silica gel column with dichloromethane/methanol (100:1). This resulted in 72.9 mg (19%) of 5-cyclopropyl-N-(2,5-dimethyl-1-[[(1R,4R)-4-aminocyclohexyl]carb- onyl]piperidin-4-yl)-1,2-oxazole-3-carboxamide as a white solid. .sup.1H-NMR (400 MHz, CD.sub.3OD): .delta. 6.40 (s, 1H), 4.89-3.70 (m, 3H), 3.32-2.68 (m, 3H), 2.27-2.09 (m, 4H), 1.95-1.90 (m, 4H), 1.68-1.47 (m, 4H), 1.34-1.11 (m, 5H), 0.92-1.01 (m, 5H) ppm. LCMS (method A, ESI): RT=1.32 min, m/z=389.0[M+H].sup.+.

Step 7: Synthesis of N-((2R,4S,5R)-1-((1r,4R)-4-Aminocyclohexanecarbonyl)-2,5-dimethylpiperidi- n-4-yl)-5-cyclopropylisoxazole-3-carboxamide

##STR01156##

The crude product was purified by Chrial-HPLC with the following conditions: Column, SHIMADZU-PDA(LC-08); mobile phase, Hex (0.2% IPA):EtOH=70:30; Detector, UV 254/220 nm. This resulted in 9.6 mg (24%) of (2S,4R,5S)-benzyl 4-(5-cyclopropylisoxazole-3-carboxamido)-2,5-dimethylpiperidine-1-carboxy- late as a white solid and 9.3 mg (23%) of (2R,4S,5R)-benzyl 4-(5-cyclopropylisoxazole-3-carboxamido)-2,5-dimethylpiperidine-1-carboxy- late was obtained as a white solid. .sup.1H-NMR (400 MHz, CD.sub.3OD): .delta. 6.30 (s, 1H), 4.76-3.60 (m, 3H), 3.10-2.90 (m, 1H), 2.85-2.75 (m, 1H), 2.61-2.45 (m, 1H), 2.10-2.03 (m, 2H), 1.93-1.73 (m, 6H), 1.57-1.31 (m, 2H), 1.31-1.02 (m, 7H), 0.89-0.84 (m, 5H) ppm. LCMS (method A, ESI): RT=1.31 min, m/z=389.0[M+H].sup.+.

Example 9

Synthesis of N-((3S,4R)-1-(3-aminopropylsulfonyl)-3-methylpiperidin-4-yl)-5-cyclopropy- lisoxazole-3-carboxamide (Cpd. No. 386)

##STR01157##

Step 1: Synthesis of tert-butyl 4-amino-3-methylpiperidine-1-carboxylate

##STR01158##

Into a 4-L round-bottom flask was placed methanol (3 L), formic acid (0.5 mL), HCOONH.sub.4 (84 g, 1.33 mol, 40.00 equiv) and tert-butyl 3-methyl-4-oxopiperidine-1-carboxylate (7 g, 32.82 mmol, 1.00 equiv). Then NaBH.sub.3CN (4.1 g, 2.00 equiv) was added into batchwise. The resulting solution was stirred for 2 hours at room temperature. The pH value of the solution was adjusted to 9 with sodium carbonate (5M in water). The resulting mixture was concentrated under vacuum. The resulting solution was diluted with 50 mL of H.sub.2O. The resulting solution was extracted with 3.times.50 mL of ethyl acetate and the organic layers combined. This resulted in 7.0 g (99% crude) of tert-butyl 4-amino-3-methylpiperidine-1-carboxylate as a white solid. .sup.1H NMR (300 MHz, DMSO): 6.39 (brs, 2H), 3.95-3.75 (m, 1.5H), 3.70-3.60 (m, 0.5H), 3.35-3.25 (brs, 0.5H), 3.05-2.95 (m, 0.5H), 2.90-2.63 (m, 1.5H), 2.45-2.25 (brs, 0.5H), 2.10-2.00 (brs, 0.5H), 1.95-1.85 (m, 0.5H), 1.65-1.45 (m, 1.5H), 1.35-1.25 (m, 0.5H), 1.38 (s, 9H), 1.20-1.10 (m, 3H) ppm. LCMS (Method A, ESI): RT=1.02 min, m/z=215.0 [M+H].sup.+.

Step 2: Synthesis of tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-3-methylpiperidine-1-carboxylate

##STR01159##

Into a 250-mL round-bottom flask was placed tert-butyl 4-amino-3-methylpiperidine-1-carboxylate (7 g, 32.66 mmol, 1.00 equiv), dichloromethane (100 mL), 5-cyclopropyl-1,2-oxazole-3-carboxylic acid (6.5 g, 42.45 mmol, 1.30 equiv), HATU (25.1 g, 104.13 mmol, 2.00 equiv). Then TEA (16.7 g, 165.04 mmol, 5.00 equiv) was added into mixture dropwise. The resulting solution was stirred for 2 h at room temperature. The resulting solution was concentrated under vacuum. The resulting solution was diluted with 50 mL of H.sub.2O. The resulting solution was extracted with 3.times.50 mL of ethyl acetate and the organic layers combined. The resulting mixture was washed with 3.times.150 mL of brine (sat.). The mixture was dried over anhydrous sodium sulfate. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1/5). This resulted in 6 g (52%) of tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-3-methylpiperidine-1-carboxylate- as yellow solid. .sup.1H NMR (400 MHz, CD.sub.3OD): 6.38 (s, 1H), 4.30-4.20 (m, 1H), 4.20-4.05 (m, 1H), 3.80-3.76 (m, 1H), 3.56-3.45 (m, 1H), 3.29-3.20 (m, 1H), 2.15-2.10 (m, 2H), 1.90-1.80 (m, 1H), 1.70-1.60 (m, 1H), 1.52 (s, 9H), 1.20-1.16 (m, 2H), 1.05-0.85 (m, 5H) ppm. LCMS (Method A, ESI): RT=1.47 min, m/z=294.0 [M+H-56].sup.+.

Step 3: Synthesis of (3S,4R)-tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-3-methylpiperidine-1-carboxylate

##STR01160##

1.5 g of tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-3-methylpiperidine-1-carboxylate was purified by Chrial-Prep-SFC with the following conditions: Column: CHIRALCEL OJ-3 (0.46*15 cm, 3 um); mobile phase, Hex:EtOH=90:10; Detector, 254 nm. This resulted in 240 mg (16%) of (3S,4R)-tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-3-methylpiperidine-1-carboxylate- as a white solid. .sup.1H NMR (400 MHz, CD.sub.3OD): 6.40 (s, 1H), 4.25-4.22 (m, 1H), 4.00-3.88 (brs, 1H), 3.77-3.55 (brs, 1H), 3.24-3.23 (m, 2H), 2.20-2.15 (m, 2H), 1.85-1.81 (m, 1H), 1.67-1.64 (m, 1H), 1.48 (s, 9H) 1.17-1.16 (m, 2H), 1.05-0.98 (m, 5H) ppm.

Step 4: Synthesis of 5-cyclopropyl-N-((3S,4R)-3-methylpiperidin-4-yl)isoxazole-3-carboxamide

##STR01161##

Into a 100-mL round-bottom flask was placed (3S,4R)-tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-3-methylpiperidine-1-carboxylate (240 mg, 0.688 mmol, 1.00 equiv), dichloromethane (30 mL). To the above hydrogen chloride was introduced. The resulting solution was stirred for 1 h at room temperature. The resulting mixture was concentrated under vacuum. The resulting solution was diluted with 10 mL of water. The pH value of the solution was adjusted to 9 with sodium carbonate (5M in water). The resulting solution was extracted with 3.times.10 mL of ethyl acetate and the organic layers combined. This resulted in 150 mg (71%) of 5-cyclopropyl-N-[(3S,4R)-3-methylpiperidin-4-yl]-1,2-oxazole-3-carboxamid- e as a white solid. 1H NMR (400 MHz, CD.sub.3OD): 6.40 (s, 1H), 4.28-4.26 (m, 1H), 3.05-2.90 (brs, 1H), 2.90-2.70 (m, 3H), 2.20-2.05 (m, 2H), 1.90-1.70 (m, 2H), 1.20-1.10 (m, 2H), 1.05-0.95 (m, 5H) ppm. LCMS (Method A, ESI): RT=0.97 min, m/z=250.0 [M+H].

Step 5: Synthesis of 5-cyclopropyl-N-((3S,4R)-1-(3-(1,3-dioxoisoindolin-2-yl)propylsulfonyl)-3- -methylpiperidin-4-yl)isoxazole-3-carboxamide

##STR01162##

Into a 25-mL round-bottom flask was placed 5-cyclopropyl-N-((3S,4R)-3-methylpiperidin-4-yl)isoxazole-3-carboxamide (150 mg, 0.60 mmol, 1.00 equiv), dichloromethane (20 mL) and TEA (180 mg, 3.00 equiv). Then 3-(1,3-dioxo-2,3-dihydro-1H-inden-2-yl)propane-1-sulfonyl chloride (207 mg, 0.72 mmol, 1.30 equiv) was added into the mixture dropwise at -20.degree. C. The resulting solution was stirred for additional 24 hours at -20.degree. C. The resulting mixture was concentrated under vacuum. The resulting mixture was triturated with 3.times.10 mL of EA. The solids were collected by filtration. This resulted in 300 mg (100%) of 5-cyclopropyl-N-[(3S,4R)-1-[[3-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)pr- opane]sulfonyl]-3-methylpiperidin-4-yl]-1,2-oxazole-3-carboxamide as a white solid. LCMS (method A, ESI): RT=1.40 min, m/z=501.0 [M+H].

Step 6: Synthesis of N-((3S,4R)-1-(3-aminopropylsulfonyl)-3-methylpiperidin-4-yl)-5-cyclopropy- lisoxazole-3-carboxamide

##STR01163##

Into a 25-mL round-bottom flask was placed 5-cyclopropyl-N-[(3S,4R)-1-[[3-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)pr- opane]sulfonyl]-3-methylpiperidin-4-yl]-1,2-oxazole-3-carboxamide (300 mg, 0.60 mmol, 1.00 equiv), methanol (10 mL) and hydrazine hydrate (1 mL, 80% in water). The resulting solution was stirred for 1 h at room temperature. The resulting mixture was concentrated under vacuum. The crude product (100 mg) was purified by Prep-HPLC with the following conditions: Column: X Bridge C18, 19*150 mm, 5 um; Mobile Phase A: Water/NH.sub.4HCO.sub.3 10 mmol, Mobile Phase B: ACN; Flow rate: 30 mL/min; Gradient: 30% B to 85% B in 10 min; Detector, 254 nm This resulted in 66.4 mg (30%) of N-[(3R,4S)-1-[(3-aminopropane)sulfonyl]-3-methylpiperidin-4-yl]-5-cyclopr- opyl-1,2-oxazole-3-carboxamide as a white solid. .sup.1H NMR (300 MHz, CD.sub.3OD) .delta.: 6.40 (s, 1H), 4.24-4.20 (m, 1H), 3.61-3.57 (m, 1H), 3.50-3.32 (m, 1H), 3.25-3.08 (m, 4H), 2.85-2.75 (m, 2H), 2.30-2.14 (m, 2H), 2.00-1.89 (m, 3H), 1.80-1.70 (m, 1H), 1.20-1.15 (m, 2H), 1.10-0.95 (m, 5H) ppm. LCMS (Method D, ESI): RT=2.11 min, m/z=371.0 [M+H].sup.+.

Example 10

Synthesis of N-[9-[(3-aminopropane)sulfonyl]-9-azabicyclo[3.3.1]nonan-3-yl]-5-cyclopro- pyl-1,2-oxazole-3-carboxamide hydrochloride salt (Cpd. No. 181

##STR01164##

Step 1: Synthesis of 5-cyclopropyl-N-(9-[[3-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)propane]su- lfonyl]-9-azabicyclo[3.3.1]nonan-3-yl)-1,2-oxazole-3-carboxamide

##STR01165##

Into a 50-mL 3-necked round-bottom flask purged and maintained with an inert atmosphere of argon was placed N-[9-azabicyclo[3.3.1]nonan-3-yl]-5-cyclopropyl-1,2-oxazole-3-carboxamide (250 mg, 0.91 mmol, 1.00 equiv), tetrahydrofuran (20 mL), the solution was cooled to -30.degree. C., then LiHMDS (3 mL) was added and stirred for 30 min at -30.degree. C., and a solution of 3-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)propane-1-sulfonyl chloride (340 mg, 1.18 mmol, 1.30 equiv) in tetrahydrofuran (3 mL) was added slowly. The resulting solution was stirred overnight at room temperature. The resulting solution was diluted with 10 mL of ethyl acetate. The solids were filtered out. The resulting filtrate was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1:1). This resulted in 200 mg (42%) of 5-cyclopropyl-N-(9-[[3-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)propane]su- lfonyl]-9-azabicyclo[3.3.1]nonan-3-yl)-1,2-oxazole-3-carboxamide as a white solid. .sup.1H-NMR (400 MHz, CDCl.sub.3): .delta. 8.50 (d, J=8.0 Hz, 1H), 7.89-7.82 (m, 4H), 6.47 (s, 1H), 4.78-4.77 (m, 1H), 4.00-3.98 (m, 2H), 3.70 (t, J=7.2 Hz, 2H), 3.20 (t, J=7.2 Hz, 2H), 2.20-2.16 (m, 1H), 2.01-1.97 (m, 2H), 1.87-1.81 (m, 7H), 1.68 (d, J=8.4 Hz, 3H), 1.13-1.06 (m, 2H), 0.93-0.89 (m, 2H) ppm. LCMS (method D, ESI): RT=1.48 min, m/z=527.1 [M+H].sup.+.

Step 2: Synthesis of N-[9-[(3-aminopropane)sulfonyl]-9-azabicyclo[3.3.1]nonan-3-yl]-5-cyclopro- pyl-1,2-oxazole-3-carboxamide hydrochloride salt

##STR01166##

Into a 250-mL round-bottom flask, was placed 5-cyclopropyl-N-(9-[[3-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)propane]su- lfonyl]-9-azabicyclo[3.3.1]nonan-3-yl)-1,2-oxazole-3-carboxamide (200 mg, 0.38 mmol, 1.00 equiv), methanol (30 mL) and hydrazine hydrate (4 mL). The resulting solution was stirred for 1 h at room temperature. The resulting mixture was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate. The crude product (200 mg) was further purified by Prep-HPLC with the following conditions: Column, X Bridge C18, 19*150 mm, 5 um; mobile phase, Mobile Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 20 mL/min; Detector, 254 nm. This resulted in 118.7 mg (72%) of N-[9-[(3-aminopropane)sulfonyl]-9-azabicyclo[3.3.1]nonan-3-yl]-5-cyclopro- pyl-1,2-oxazole-3-carboxamide hydrochloride as a white solid. .sup.1H-NMR (300 MHz, CD.sub.3OD): .delta. 6.40 (s, 1H), 5.04-4.89 (m, 1H), 4.14 (brs, 2H), 3.24 (t, J=7.5 Hz, 2H), 3.13 (t, J=7.8 Hz, 2H), 2.20-1.77 (m, 13H), 1.17-1.12 (m, 2H), 0.99-0.94 (m, 2H) ppm. LCMS (method D, ESI): RT=1.35 min, m/z=397.0 [M+H].sup.+.

Example 11

Synthesis of 5-cyclopropyl-N-[(2S,4S)-2-methyl-1-(4-methylpiperazine-1-sulfonyl) piperidin-4-yl]-1,2-oxazole-3-carboxamide (Cpd. No. 279)

##STR01167##

Into a 50-mL 3-necked round-bottom flask was placed 5-cyclopropyl-N-((2S,4S)-2-methylpiperidin-4-yl)isoxazole-3-carboxamide hydrochloride (200 mg, 0.70 mmol, 1.00 equiv), dichloromethane (10 mL) and TEA (353 mg, 3.49 mmol, 4.98 equiv). This was followed by the addition of 4-methylpiperazine-1-sulfonyl chloride (166 mg, 0.84 mmol, 1.19 equiv) at -20.degree. C. The resulting solution was stirred at room temperature overnight. The reaction progress was monitored by LCMS. The resulting mixture was washed with 2.times.5 mL of H.sub.2O. The residue was purified on a silica gel column with dichloromethane/methanol (20:1). This resulted in 136.3 mg (47%) of 5-cyclopropyl-N-[(2S,4S)-2-methyl-1-(4-methylpiperazine-1-sulfonyl)piperi- din-4-yl]-1,2-oxazole-3-carboxamide as a white solid. .sup.1H NMR (300 MHz, CD.sub.3OD) .delta.: 6.37 (s, 1H), 4.14-4.11 (m, 1H), 3.76-3.63 (m, 2H), 3.27-3.24 (m, 1H), 3.21 (t, 4H), 2.51 (t, 4H), 2.32 (s, 3H), 2.19-2.13 (m, 1H), 2.01-1.95 (m, 2H), 1.85-1.65 (m, 2H), 1.41 (d, 3H), 1.17-1.10 (m, 2H), 0.99-0.94 (m, 2H) ppm. LCMS (Method D, ESI): RT=1.74 min, m/z=412.0 [M+H].sup.+.

Example 12

Synthesis of N-((2S,4S)-2-benzyl-1-(2-(piperidin-4-yl)acetyl)piperidin-4-yl)-5-cyclopr- opylisoxazole-3-carboxamide hydrochloride (Cpd. No. 348)

##STR01168##

Step 1: Synthesis of tert-butyl 4-[2-[(2S,4S)-2-benzyl-4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidin-1-y- l]-2-oxoethyl]piperidine-1-carboxylate

##STR01169##

Into a 250-mL round-bottom flask was placed N-[(2S,4S)-2-benzylpiperidin-4-yl]-5-cyclopropyl-1,2-oxazole-3-carboxamid- e (100 mg, 0.31 mmol, 1.00 equiv), dichloromethane (50 mL), HATU (353 mg, 0.93 mmol, 3.02 equiv), TEA (157 mg, 1.55 mmol, 5.05 equiv), 2-[1-[(tert-butoxy)carbonyl]piperidin-4-yl]acetic acid (75 mg, 0.31 mmol, 1.00 equiv). The resulting solution was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1:1). This resulted in 130 mg (77%) of tert-butyl 4-[2-[(2S,4S)-2-benzyl-4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidin-1-y- l]-2-oxoethyl]piperidine-1-carboxylate as a yellow solid. LCMS (method A, ESI): RT=1.13 min. m/z=451.0 [M-Boc].sup.+.

Step 2: Synthesis of N-((2S,4S)-2-benzyl-1-(2-(piperidin-4-yl)acetyl)piperidin-4-yl)-5-cyclopr- opylisoxazole-3-carboxamide hydrochloride

##STR01170##

Into a 100-mL round-bottom flask was placed tert-butyl 4-[2-[(2S,4S)-2-benzyl-4-(5-cyclopropyl-1,2-oxazole-3-amido)piperidin-1-y- l]-2-oxo ethyl]piperidine-1-carboxylate (130 mg, 0.24 mmol, 1.00 equiv) and 1,4-dioxane (20 mL). Then hydrogen chloride was introduced into mixture. The resulting solution was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. This resulted in 64.0 mg (56%) of N-[(2S,4S)-2-benzyl-1-[2-(piperidin-4-yl)acetyl]piperidin-4-yl]-5-cyclopr- opyl-1,2-oxazole-3-carboxamide hydrochloride as a white solid. .sup.1H NMR (400 MHz, D.sub.2O): .delta.: 7.22-7.06 (m, 5H), 6.30 (s, 1H), 4.70 (s, 0.5H), 4.38-4.30 (m, 0.5H), 4.30-4.15 (m, 0.5H), 4.15-3.95 (m, 1H), 3.75-3.65 (m, 0.5H), 3.65-3.45 (m, 0.5H), 3.30-3.01 (m, 3H), 3.01-2.90 (m, 0.5H), 2.90-2.70 (m, 3H), 2.45-2.35 (m, 0.5H), 2.20-2.01 (m, 2H), 2.01-1.81 (m, 4H), 1.81-1.65 (m, 1.5H), 1.65-1.51 (m, 1H), 1.51-1.41 (m, 1H), 1.41-1.39 (m, 1.5H), 1.10-1.01 (m, 2H), 0.98-0.83 (m, 2.5H) ppm. LCMS (method D, ESI): RT=1.98 min. m/z=451.0 [M-HCl].sup.+.

Example 13

Synthesis of N-((1S,3r,5R)-8-(3-aminopropylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-5- -cyclopropylisoxazole-3-carboxamide (Cpd. No. 485)

##STR01171##

Step 1: Synthesis of N-((1R,3r,5S)-8-(3-chloropropylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-- 5-cyclopropylisoxazole-3-carboxamide

##STR01172##

Into a 25-mL round-bottom flask was placed N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-5-cyclopropyl-1,2-oxazole-3-- carboxamide (200 mg, 0.62 mmol, 1.00 equiv), dichloromethane (5 mL), TEA (189 mg, 1.87 mmol, 3.00 equiv). This was followed by the added of 3-chloropropane-1-sulfonyl chloride (143 mg, 0.81 mmol, 1.30 equiv) dropwise at 0.degree. C. The resulting solution was stirred overnight at 25.degree. C. The solution was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1:1). This resulted in 240 mg (96%) of N-[(1R,3r5S)-8-[(3-chloropropane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]- -5-cyclopropyl-1,2-oxazole-3-carboxamide as yellow oil. LCMS (method D, ESI): RT=0.97 min, m/z=402.0 [M+H].sup.+.

Step 2: Synthesis of 5-cyclopropyl-N-((1S,3r,5R)-8-(3-(1,3-dioxoisoindolin-2-yl)propylsulfonyl- )-8-aza-bicyclo[3.2.1]octan-3-yl)isoxazole-3-carboxamide

##STR01173##

Into a 25-mL round-bottom flask was placed N-[(1R,3S,5S)-8-[(3-chloropropane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl- ]-5-cyclopropyl-1,2-oxazole-3-carboxamide (100 mg, 0.25 mmol, 1.00 equiv), N,N-dimethylformamide (5 mL), 2-potassio-2,3-dihydro-1H-isoindole-1,3-dione (92 mg, 0.50 mmol, 2.00 equiv). The resulting solution was stirred for 2 h at 80.degree. C. The resulting solution was extracted with 3.times.50 ml, of ethyl acetate and the organic layers combined. The resulting mixture was washed with 3.times.70 mL of water. The mixture was dried over anhydrous sodium sulfate and concentrated under vacuum. This resulted in 120 mg (94%) of 5-cyclopropyl-N-[(1R,3r,5S)-8-[[3-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl- )propane]sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-1,2-oxazole-3-carboxamid- e as a white solid. LCMS (method D, ESI): RT=0.98 min, m/z=513.0 [M+H].sup.+.

Step 3: Synthesis of N-((1S,3r,5R)-8-(3-aminopropylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-5- -cyclopropylisoxazole-3-carboxamide

##STR01174##

Into a 25-mL round-bottom flask was placed 5-cyclopropyl-N-[(1R,3r,5S)-8-[[3-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl- )propane]sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-1,2-oxazole-3-carboxamid- e (120 mg, 0.23 mmol, 1.00 equiv) and N.sub.2H.sub.4.H.sub.2O (0.2 mL), methanol (7 mL). The resulting solution was stirred for 4 h at 25.degree. C. The mixture was concentrated under vacuum and then dissolved in 50 mL ethyl acetate. The solids were filtered out. The filtrate was concentrated under vacuum. The crude product (100 mg) was purified by Prep-HPLC with the following conditions (1#-Waters 2767-1): Column, X-bridge Prep phenyl 5 um, 19*150 mmh Prep C012(T)186003581138241113.01; mobile phase, Phase A: water with 0.5% NH.sub.4HCO.sub.3, Phase B: CH.sub.3CN. Water with 0.5% NH.sub.4HCO.sub.3 and CH.sub.3CN (30% CH.sub.3CN up to 60% in 12 min, hold 95% in 1 min, down to 30% in 1 min); Detector, uv254 nm. This resulted in 50.7 mg (57%) of N-[(1R,3r,5S)-8-[(3-aminopropane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]- -5-cyclopropyl-1,2-oxazole-3-carboxamide as a white solid. .sup.1H NMR (400 MHz, CD.sub.3OD): 6.28 (s, 1H), 4.13 (s, 2H), 4.07-4.04 (m, 1H), 3.07-3.03 (m, 2H), 2.69-2.66 (m, 2H), 2.21-2.15 (m, 2H), 2.08-1.80 (m, 9H), 1.06-1.01 (m, 2H), 0.89-0.85 (m, 2H) ppm. LCMS (method D, ESI): RT=1.30 min, m/z=383.0 [M+H].sup.+.

Example 14

Synthesis of 5-cyclopropyl-N-((1R,3s,5S)-8-((2-(pyrrolidin-1-yl)ethyl)sulfonyl)-8-azab- icyclo[3.2.1]octan-3-yl)isoxazole-3-carboxamide (Cpd. No. 436

##STR01175##

Step 1: Synthesis of 5-cyclopropyl-N-((1R,3s,5S)-8-(vinylsulfonyl)-8-azabicyclo[3.2.1]octan-3-- yl)isoxazole-3-carboxamide

##STR01176##

Into a 50-mL round-bottom flask was placed N-[(1R,3s,5S)-8-azabicyclo[3.2.1]octan-3-yl]-5-cyclopropyl-1,2-oxazole-3-- carboxamide hydrochloride (100 mg, 0.34 mmol, 1.00 equiv), TEA (102 mg, 1.01 mmol, 3.00 equiv), dichloromethane (5 mL). This was followed by the dropwise addition of ethenesulfonyl chloride (61 mg, 0.48 mmol, 1.30 equiv) at 0.degree. C. Then the resulting solution was stirred for 2 h at 25.degree. C. The resulting mixture was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (3:1). This resulted in 100 mg (85%) of 5-cyclopropyl-N-[(1R,3s,5S)-8-(ethenesulfonyl)-8-azabicyclo[3.2.1]octan-3- -yl]-1,2-oxazole-3-carboxamide as a light brown solid. LCMS (method D, ESI): RT=0.59 min, m/z=383.1 [M+Na].sup.+.

Step 2: Synthesis of 5-cyclopropyl-N-((1R,3s,5S)-8-((2-(pyrrolidin-1-yl)ethyl)sulfonyl)-8-azab- icyclo[3.2.1]octan-3-yl)isoxazole-3-carboxamide

##STR01177##

Into a 50-mL round-bottom flask was placed 5-cyclopropyl-N-[(1R,3s,5S)-8-(ethenesulfonyl)-8-azabicyclo[3.2.1]octan-3- -yl]-1,2-oxazole-3-carboxamide (90 mg, 0.26 mmol, 1.00 equiv), ethanol (10 mL), and pyrrolidine (0.2 mL). The resulting solution was stirred at 25.degree. C. overnight. The resulting mixture was concentrated under vacuum. The crude product (89 mg) was purified by Prep-HPLC with the following conditions (1#-Waters 2767-1): Column, X-bridge Prep phenyl 5 um, 19*150 mmh Prep C012(T)186003581138241113.01; mobile phase, Phase A: water with 0.5% NH.sub.4HCO.sub.3, Phase B: CH.sub.3CN. Water with 0.5% NH.sub.4HCO.sub.3 and CH.sub.3CN (80% CH.sub.3CN up to 95% in 13 min, hold 95% in 1 min, down to 80% in 1 min); Detector, uv254 nm. This resulted in 60.3 mg (56%) of 5-cyclopropyl-N-[(1R,3s,5S)-8-[ [2-(pyrrolidin-1-yl)ethane]sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-1,2-o- xazole-3-carboxamide as a white solid. .sup.1H-NMR (400 MHz, CD.sub.3OD): .delta.6.27 (s, 1H), 4.21-4.11 (m, 2H), 4.02-4.08 (m, 1H), 3.22-3.18 (m, 2H), 2.84-2.79 (m, 2H), 2.52-2.49 (m, 4H), 2.19-2.14 (m, 2H), 2.08-1.72 (m, 11H), 1.06-1.01 (m, 2H), 0.89-0.85 (m, 2H) ppm. LCMS (method D, ESI): RT=1.36 min, m/z=423 [M+H].sup.+.

Example 15

Synthesis of N-((2S,4S)-1-(3-(benzylamino)propylsulfonyl)-2-methylpiperidin-4-yl)-5-cy- clopropylisoxazole-3-carboxamide (Cpd. No. 500)

##STR01178##

Step 1: Synthesis of (2S)-tert-butyl 4-amino-2-methylpiperidine-1-carboxylate

##STR01179##

Into a 10-L round-bottom flask was placed methanol (5 L), HCOONH.sub.4 (190 g, 3.01 mol, 37.80 equiv), acetic acid (5 g, 83.26 mmol, 1.04 equiv) and tert-butyl (2S)-2-methyl-4-oxopiperidine-1-carboxylate (17 g, 79.71 mmol, 1.00 equiv). Then NaBH.sub.3CN (10 g, 159.13 mmol, 2.00 equiv) was added into the mixture slowly. The resulting solution was stirred overnight at 25.degree. C. The resulting mixture was concentrated under vacuum. The resulting solution was diluted with 500 mL of ethyl acetate. The resulting mixture was washed with 3.times.500 mL of brine (sat.). The resulting organic phase was concentrated under vacuum. This resulted in 15.5 g (91%) of tert-butyl (2S)-4-amino-2-methylpiperidine-1-carboxylate as off-white oil. LCMS (method A, ESI): RT=1.21 min, m/z=215.1 [M+H].sup.+.

Step 2: Synthesis of (2S)-tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-2-methylpiperidine-1-carboxylate

##STR01180##

Into a 1 L round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed dichloromethane (500 mL), HOBT (15 g, 111.01 mmol, 1.53 equiv), EDCI (20 g, 104.33 mmol, 1.44 equiv), 5-cyclopropyl-1,2-oxazole-3-carboxylic acid (13.3 g, 86.85 mmol, 1.20 equiv) and tert-butyl (2S)-4-amino-2-methylpiperidine-1-carboxylate (15.5 g, 72.33 mmol, 1.00 equiv). Then triethylamine (36 g, 355.77 mmol, 4.92 equiv) was added dropwise. The resulting solution was stirred for 2 hours at 25.degree. C. The resulting mixture was concentrated under vacuum. The resulting solution was diluted with 500 mL of ethyl acetate. The resulting mixture was washed with 3.times.500 mL of water. The resulting organic phase was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/petroleum ether (1:10). This resulted in 14 g (55%) of tert-butyl (2 S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carboxylate as light yellow oil. LCMS (method A, ESI): RT=2.05 min, m/z=350.2 [M+H].sup.+.

Step 3: Synthesis of (2S,4S)-tert-butyl 4-(5-cyclopropylisoxazole-3-carboxamido)-2-methylpiperidine-1-carboxylate

##STR01181##

The diastereomeric product was further purified by Chiral-HPLC with the following conditions: Column name: CHIRALPAK AD-H, 4.6*150 mm, 5 um, Co-Solvent: EtOH (0.1% DEA), % Co-Solvent: Hexane, 25.000, Detector: 220 nm. The resulting solution was concentrated under vacuum. This resulted in 9.8 g (70%) of tert-butyl (2S,4S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate as colorless oil. .sup.1H-NMR (400 MHz, DMSO): .delta. 8.54-8.52 (m, 1H), 6.47 (s, 1H), 3.94-3.87 (m, 2H), 3.57-3.53 (m, 1H), 3.32-3.26 (m, 1H), 2.20-2.16 (m, 1H), 1.80-1.63 (m, 4H), 1.39 (s, 9H), 1.16-1.15 (m, 3H), 1.10-1.06 (m, 2H), 0.93-0.89 (m, 2H) ppm and 3.3 g (24%) of tert-butyl (2S,4R)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate as a light yellow solid. .sup.1H-NMR (400 MHz, DMSO): .delta. 8.54-8.52 (m, 1H), 6.46 (s, 1H), 4.54-4.30 (m, 1H), 4.28-4.04 (m, 1H), 4.00-3.68 (m, 1H), 3.10-2.70 (m, 1H), 2.19-2.15 (m, 1H), 1.76-1.73 (m, 1H), 1.63-1.59 (m, 2H), 1.39-1.35 (m, 10H), 1.13-1.08 (m, 5H), 1.00-0.82 (m, 2H) ppm.

Step 4: Synthesis of 5-cyclopropyl-N-((2S,4S)-2-methylpiperidin-4-yl)isoxazole-3-carboxamide hydrochloride

##STR01182##

Into a 250-mL round-bottom flask was placed dichloromethane (100 mL) and tert-butyl (2S,4S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carbox- ylate (9.8 g, 28.05 mmol, 1.00 equiv). To the above hydrogen chloride (gas) was introduced into mixture. The resulting solution was stirred for 2 hours at 25.degree. C. The resulting mixture was concentrated under vacuum. This resulted in 8.6 g of 5-cyclopropyl-N-[(2S,4S)-2-methylpiperidin-4-yl]-1,2-oxazole-3-carboxamid- e hydrochloride as a white solid. .sup.1HNMR (400 MHz, MeOD): .delta. 6.40 (s, 1H), 4.24-4.10 (m, 1H), 3.55-3.45 (m, 1H), 3.40-3.35 (m, 1H), 3.19-3.15 (m, 1H), 2.24-2.15 (m, 3H), 1.82-1.77 (m, 1H), 1.63-1.60 (m, 1H), 1.93-1.37 (m, 3H), 1.21-1.13 (m, 2H), 1.00-0.96 (m, 2H) ppm. LCMS (method A, ESI): RT=1.13 min, m/z=250.1 [M-HCl+H].sup.+.

Step 5: Synthesis of N-((2S,4S)-1-(3-chloropropylsulfonyl)-2-methylpiperidin-4-yl)-5-cycloprop- ylisoxazole-3-carboxamide

##STR01183##

Into a 25-mL round-bottom flask was placed dichloromethane (5 mL), triethylamine (121 mg, 1.20 mmol, 2.98 equiv) and 5-cyclopropyl-N-[(2S,4S)-2-methylpiperidin-4-yl]-1,2-oxazole-3-carboxamid- e (100 mg, 0.40 mmol, 1.00 equiv). Then 3-chloropropane-1-sulfonyl chloride (106 mg, 0.60 mmol, 1.49 equiv) was added dropwise at 0.degree. C. The resulting solution was stirred for 16 hours at 25.degree. C. The resulting mixture was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/hexane (1:1). This resulted in 85 mg (54%) of N-[(2S,4S)-1-[(3-chloropropane)sulfonyl]-2-methylpiperidin-4-yl]-5-cyclop- ropyl-1,2-oxazole-3-carboxamide as a white solid. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 6.38 (s, 1H), 4.13-4.01 (m, 1H), 3.80-3.72 (m, 3H), 3.66-3.65 (m, 1H), 3.26-3.19 (m, 3H), 2.19-2.00 (m, 3H), 2.04-1.98 (m, 2H), 1.77-1.70 (m, 2H), 1.43 (d, J=6.8 Hz, 3H), 1.00-0.97 (m, 2H), 1.16-1.12 (m, 2H) ppm. LCMS (method A, ESI): RT=1.37 min, m/z=390.0 [M+H].sup.+.

Step 6: Synthesis of N-((2S,4S)-1-(3-(benzylamino)propylsulfonyl)-2-methylpiperidin-4-yl)-5-cy- clopropylisoxazole-3-carboxamide

##STR01184##

Into a 10 mL round-bottom flask was placed 1,4-dioxane (3 mL), N-[(2S,4S)-1-[(3-chloropropane)sulfonyl]-2-methylpiperidin-4-yl]-5-cyclop- ropyl-1,2-oxazole-3-carboxamide (84 mg, 0.22 mmol, 1.00 equiv), and phenylmethanamine (274 mg, 2.56 mmol, 11.87 equiv). The resulting solution was stirred for 16 hours at 100.degree. C. The resulting mixture was concentrated under vacuum. The residue was purified on a silica gel column with ethyl acetate/hexane (1:1). This resulted in 30.1 mg (30%) of N-[(2S,4S)-1-[[3-(benzylamino)propane]sulfonyl]-2-methylpiperidin-4-yl]-5- -cyclopropyl-1,2-oxazole-3-carboxamide as a white solid. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 7.37-7.29 (m, 5H), 6.38 (s, 1H), 4.13-4.01 (m, 1H), 3.82 (s, 2H), 3.80-3.78 (m, 1H), 3.62 (d, J=3.2 Hz, 1H), 3.18-3.11 (m, 3H), 2.78 (t, J=3.2 Hz, 2H), 2.18-2.16 (m, 1H), 2.04-1.97 (m, 4H), 1.77-1.70 (m, 2H), 1.43 (d, J=6.8 Hz, 3H), 1.00-0.97 (m, 2H), 1.16-1.12 (m, 2H) ppm. LCMS (method A, ESI): RT=1.48 min, m/z=461.3 [M+H].sup.+.

Example 16

Synthesis of 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(6-(2-morpholinoethylamino) pyridin-3-ylsulfonyl)piperidin-4-yl)isoxazole-3-carboxamide dihydrochloride (Cpd. No. 458)

##STR01185##

Step 1: Synthesis of N-((2S,4S)-1-(6-chloropyridin-3-ylsulfonyl)-2-methylpiperidin-4-yl)-5-cyc- lopropylisoxazole-3-carboxamide

##STR01186##

Into a 50-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed 5-cyclopropyl-N-((2S,4S)-2-methylpiperidin-4-yl)isoxazole-3-carboxamide hydrochloride (200 mg, 0.69 mmol, 1.00 equiv). Then triethylamine (210 mg, 2.09 mmol, 3.00 equiv) was added into dropwise. The reaction mixture was cooled to 0.degree. C., then 6-chloropyridine-3-sulfonyl chloride (220 mg, 1.04 mmol, 1.50 equiv) was added dropwise. The resulting solution was stirred at room temperature for 15 h. The resulting mixture was washed by water (3.times.10 ml), dried over Na.sub.2SO.sub.4 and concentrated under vacuum. This resulted in 296 mg (97%) of N-((2S,4S)-1-(6-chloropyridin-3-ylsulfonyl)-2-methylpiperidin-4-yl)-5-cyc- lopropylisoxazole-3-carboxamide as light yellow solid. LCMS (method D, ESI): RT=1.47 min, m/z=425 [M+H].sup.+.

Step 2: Synthesis of 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(6-(2-morpholinoethylamino) pyridin-3-ylsulfonyl)piperidin-4-yl)isoxazole-3-carboxamide dihydrochloride

##STR01187##

Into a 50-mL round-bottom flask was placed N-((2S,4S)-1-(6-chloropyridin-3-ylsulfonyl)-2-methylpiperidin-4-yl)-5-cyc- lopropylisoxazole-3-carboxamide (296 mg, 0.69 mmol, 1.00 equiv), 2-morpholinoethanamine (226 mg, 1.74 mmol, 2.4 equiv) and 1,4-dioxane (5 mL). The resulting solution was stirred at 80.degree. C. for 15 h. The resulting mixture was purified by pre-HPLC. Column: X Select C18, 19.times.150 mm, 5 um; Mobile Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 30 mL/min; Gradient: 5% B to 45% B in 11.5 min; 254 nm. This resulting eluent was acidified by hydrochloric acid (6Nand concentrated resulting in 102.80 mg (28%) of 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(6-(2-morpholinoethylamino)pyridin-3-- ylsulfonyl)piperidin-4-yl)isoxazole-3-carboxamide dihydrochloride as light yellow solid. .sup.1H-NMR (300 MHz, D.sub.2O): .delta. 8.44 (s, 1H), 7.94 (d, J=9.0 Hz, 1H), 6.85 (d, J=9.0 Hz, 1H), 6.29 (s, 1H), 4.14-3.08 (m, 16H), 2.12-2.08 (m, 1H), 1.97-1.86 (m, 2H), 1.64-1.79 (m, 2H), 1.26-1.24 (d, J=6.0 Hz, 3H), 1.08-1.05 (m, 2H), 0.99-0.74 (m, 2H) ppm. LCMS (method D, ESI): RT=2.37 min, m/z=519.0 [M+H].sup.+.

Example 17

Synthesis of 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((piperidin-4-ylmethyl)sulfonyl)piper- idin-4-yl)isoxazole-3-carboxamide (Cpd. No. 417) and 5-cyclopropyl-N-((2R,4R)-2-methyl-1-((piperidin-4-ylmethyl)sulfonyl)piper- idin-4-yl)isoxazole-3-carboxamide (Cpd. No. 418)

##STR01188##

Step 1: Synthesis of tert-butyl 4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carboxylate

##STR01189##

To a solution of cis tert-butyl 4-amino-2-methylpiperidine-1-carboxylate (1 g, 4.67 mmol) and DIPEA (2.44 ml, 14 mmol) in DMF (25 ml) was added 5-cyclopropyl-1,2-oxazole-3-carboxylic acid (0.86 g, 5.6 mmol) followed by HATU (2.31 g, 6.07 mmol). The reaction was stirred at rt. LCMS analysis after .about.1 h showed a trace of SM and mainly product (72%, 1.33 min, MNa+.=371.95). The reaction was poured into water (100 ml) and the product was extracted with EtOAc (3.times.50 ml). The combined organic layers were washed with water (2.times.50 ml), brine (50 ml), dried over Na.sub.2SO.sub.4, filtered and concentrated. The red oily residue was purified by Isolera over SiO.sub.2 (100 g), eluting with a gradient of EtOAc in heptane from 5 to 50% to yield 1.55 g (95%) of the amide as an amber viscous. TLC (25% EtOAc in Hept), rf:0.30. .sup.1H NMR (500 MHz, Chloroform-d) .delta. 6.85 (d, J=6.8 Hz, 1H), 6.31 (s, 1H), 4.21 (hept, J=6.8, 6.1 Hz, 2H), 3.85 (ddd, J=14.0, 5.5, 3.1 Hz, 1H), 3.13 (ddd, J=14.3, 11.9, 3.9 Hz, 1H), 2.06 (ddd, J=8.4, 4.9, 3.4 Hz, 1H), 2.02-1.91 (m, 2H), 1.74-1.66 (m, 2H), 1.45 (s, 9H), 1.25 (d, J=7.2 Hz, 3H), 1.13-1.08 (m, 2H), 1.00-0.94 (m, 2H). LCMS analysis (METCR1673 Generic 2 minutes), 100%, 1.33 min, [MNa].sup.+.=372.00.

Step 2: Synthesis of 5-cyclopropyl-N-(2-methylpiperidin-4-yl)-1,2-oxazole-3-carboxamide hydrochloride

##STR01190##

A solution of tert-butyl 4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-carboxylate (1.55 g, 4.44 mmol) in DCM (50 ml) was treated with 4M HCl in dioxane (15 ml) at rt for .about.4 h. LCMS analysis showed complete reaction. The solvent was evaporated to dryness to yield 1.12 g (88%) of the amine as HCl salt as a white solid. .sup.1H NMR (250 MHz, Methanol-d4) .delta. 6.38 (s, 1H), 4.17 (tt, J=11.9, 4.1 Hz, 1H), 3.53-3.34 (m, 2H), 3.14 (td, J=13.3, 3.1 Hz, 1H), 2.28-2.08 (m, 3H), 1.94-1.52 (m, 2H), 1.37 (d, J=6.5 Hz, 3H), 1.20-1.09 (m, 2H), 1.00-0.91 (m, 2H). LCMS analysis (METCR1673 Generic 2 minutes), 100%, .about.0.45 min, [MH-HCl].sup.+=250.00.

Step 3: Synthesis of benzyl 4-({[4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidin-1-yl]sulfony- l}methyl)piperidine-1-carboxylate

##STR01191##

To a solution of 5-cyclopropyl-N-(2-methylpiperidin-4-yl)-1,2-oxazole-3-carboxamide hydrochloride (920 mg, 3.22 mmol) in DCM (40 ml) was added DIPEA (3.37 ml, 19.3 mmol) followed by benzyl 4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (1175 mg, 3.54 mmol) as a solution in DCM (10 ml) and the reaction was left at rt overnight. The reaction was diluted with DCM (100 ml) and washed with water (50 ml) and brine (50 ml). The combined aqueous layers were back-extracted with EtOAc (2.times.25 ml). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and concentrated. The residue was purified by Isolera over SiO.sub.2 (100 g), dry loaded and eluted with a gradient of EtOAc in heptane from 12 to 100% then with a gradient of MeOH in EtOAc from 0 to 20% to yield 0.92 g (47%) of sulfonamide as a white solid. TLC (2.5% MeOH in DCM), rf:0.30. .sup.1H NMR (500 MHz, Chloroform-d) .delta. 7.40-7.28 (m, 5H), 6.77 (d, J=7.4 Hz, 1H), 6.32 (s, 1H), 5.12 (s, 2H), 4.20 (ddt, J=16.0, 7.7, 4.5 Hz, 3H), 3.76-3.63 (m, 2H), 3.21 (ddd, J=13.5, 7.4, 3.8 Hz, 1H), 2.83 (hept, J=6.4 Hz, 4H), 2.24-1.90 (m, 6H), 1.79-1.69 (m, 2H), 1.44 (d, J=6.9 Hz, 3H), 1.33-1.22 (m, 2H), 1.16-1.09 (m, 2H), 1.01-0.96 (m, 2H). LCMS analysis (METCR1673 Generic 2 minutes), 100%, 1.38 min, [MH].sup.+.=545.00.

Step 4: Synthesis of 5-cyclopropyl-N-[2-methyl-1-(piperidin-4-ylmethanesulfonyl) piperidin-4-yl]-1,2-oxazole-3-carboxamide

##STR01192##

To a solution of benzyl 4-({[4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidin-1-yl]sulfony- l}methyl)piperidine-1-carboxylate (90%, 917 mg, 1.52 mmol) in MeCN (50 ml) and DCM (5 ml) was added TMS-I (647 .mu.l, 4.55 mmol) at rt for 1 h. The solution was then added onto 50 ml of 0.5M HCl in MeOH and the mixture was stirred at rt for an additional .about.2 h. The solvent was evaporated and the residue was purified by Isolute SCX-2 (10 g cartridge) eluted with MeOH (15.times.10 ml) then with 7N NH.sub.3 in MeOH to yield 636 mg (96%) of 5-cyclopropyl-N-(2-methyl-1-((piperidin-4-ylmethyl)sulfonyl)piperidin-4-y- l)isoxazole-3-carboxamide as a white solid. .sup.1H NMR (500 MHz, Chloroform-d) .delta. 6.79 (d, J=7.2 Hz, 1H), 6.32 (s, 1H), 4.20 (ddq, J=12.0, 7.7, 4.6 Hz, 1H), 3.74-3.64 (m, 2H), 3.21 (ddd, J=13.4, 7.4, 3.8 Hz, 1H), 3.09 (d, J=12.3 Hz, 2H), 2.83 (h, J=6.9, 6.3 Hz, 2H), 2.70-2.63 (m, 2H), 2.06 (dddt, J=17.4, 13.0, 8.2, 5.1 Hz, 4H), 1.94 (d, J=12.5 Hz, 2H), 1.73 (dt, J=13.7, 6.3 Hz, 5H), 1.45 (d, J=6.9 Hz, 3H), 1.37-1.26 (m, 2H), 1.14-1.09 (m, 2H), 1.00-0.96 (m, 2H). LCMS analysis (METCR1673 Generic 2 minutes), 94%, 0.90 min, [MH].sup.+.=411.00.

Step 5: Chiral separation of 5-cyclopropyl-N-[2-methyl-1-(piperidin-4-ylmethanesulfonyl)piperidin-4-yl- ]-1,2-oxazole-3-carboxamide

##STR01193##

The racemic mixture of 5-cyclopropyl-N-(2-methyl-1-((piperidin-4-ylmethyl)sulfonyl)piperidin-4-y- l)isoxazole-3-carboxamide (94%, 636 mg, 1.46 mmol) of the cis isomers were purified by chiral separation using the following conditions: 25% Methanol+0.1% DEA:80% CO2 with Chiralpak AD-H 25 cm column at 15 ml/min. 254 mg (43%) of racemic mixture was recovered. 118 mg (20%) of 5-cyclopropyl-N-((2S,4S)-2-methyl-1-((piperidin-4-ylmethyl)sulfonyl)piper- idin-4-yl)isoxazole-3-carboxamide (arbitrarily assigned as (S,S)-isomer) was isolated at 100% ee, having a retention time on chiral column of 3.21 min. .sup.1H NMR (500 MHz, Methanol-d4) .delta. 6.36 (s, 1H), 4.10 (tt, J=9.1, 4.6 Hz, 1H), 3.77 (ddd, J=13.4, 6.7, 4.0 Hz, 1H), 3.63-3.55 (m, 1H), 3.15 (ddd, J=13.2, 8.5, 3.7 Hz, 1H), 3.07-3.02 (m, 2H), 3.01-2.93 (m, 2H), 2.63 (td, J=12.5, 2.7 Hz, 2H), 2.15 (tt, J=8.5, 5.0 Hz, 1H), 2.12-1.90 (m, 5H), 1.77-1.67 (m, 2H), 1.41 (d, J=6.7 Hz, 3H), 1.33 (qd, J=12.0, 3.6 Hz, 2H), 1.16-1.10 (m, 2H), 0.98-0.94 (m, 2H). LCMS analysis (METCR1416 Hi res 7 min), 100%, 2.74 min, [MH].sup.+.=411.00. 119 mg (19%) of 5-cyclopropyl-N-((2R,4R)-2-methyl-1-((piperidin-4-ylmethyl)sulfo- nyl)piperidin-4-yl)isoxazole-3-carboxamide (arbitrarily assigned as (R,R) isomer) was isolated at 96% ee, having a retention time on chiral column of 4.77 min. .sup.1H NMR (500 MHz, Methanol-d4) .delta. 6.36 (s, 1H), 4.10 (tt, J=9.1, 4.6 Hz, 1H), 3.77 (ddd, J=13.4, 6.7, 4.0 Hz, 1H), 3.63-3.55 (m, 1H), 3.15 (ddd, J=13.0, 8.5, 3.7 Hz, 1H), 3.04 (d, J=12.7 Hz, 2H), 3.02-2.93 (m, 2H), 2.64 (td, J=12.5, 2.6 Hz, 2H), 2.15 (tt, J=8.4, 5.0 Hz, 1H), 2.12-1.91 (m, 5H), 1.77-1.67 (m, 2H), 1.41 (d, J=6.7 Hz, 3H), 1.33 (qd, J=12.0, 3.1 Hz, 2H), 1.15-1.11 (m, 2H), 0.98-0.94 (m, 2H). LCMS analysis (METCR1416 Hi res 7 min), 100%, 2.74 min, [MH].sup.+.=410.95.

Example 18

Synthesis of 5-cyclopropyl-N-((1R,3r,5S)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicycl- o [3.2.1] octan-3-yl) isoxazole-3-carboxamide (Cpd. No. 543)

##STR01194##

Step 1: Synthesis of benzyl 4-(((1S,3r,5R)-3-(5-cyclopropylisoxazole-3-carboxamido)-8-aza-bicyclo[3.2- .1]octan-8-ylsulfonyl)methyl)piperidine-1-carboxylate

##STR01195##

Into a 25-mL round-bottom flask was placed N-((1S,3R,5R)-8-aza-bicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-ca- rboxamide hydrochloride (80 mg, 0.27 mmol, 1.00 equiv), dichloromethane (5 mL), TEA (81 mg, 0.80 mmol, 3.00 equiv), and 4-dimethylaminopyridine (33 mg, 0.27 mmol, 1.00 equiv). This was followed by the addition of benzyl 4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (140 mg, 0.42 mmol, 1.50 equiv) dropwise at 0.degree. C. The resulting solution was stirred for 4 h at 25.degree. C. The reaction was quenched with water/ice (20 mL) and extracted with EA (20 mL, three times). The organic extracts were combined and washed with brine (20 mL), then dried over with Na.sub.2SO.sub.4. After evaporation, the residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (2:3). This resulted in 70 mg (47%) of benzyl 4-(((1S, 3R, 5R)-3-(5-cyclopropylisoxazole-3-carboxamido)-8-aza-bicyclo [3.2.1] octan-8-ylsulfonyl) methyl) piperidine-1-carboxylate as a yellow solid. LCMS (method A, ESI): RT=1.09 min, m/z=557.0 [M+H].sup.+.

Step 2: Synthesis of 5-cyclopropyl-N-((1R, 3rR, 5S)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl) isoxazole-3-carboxamide

##STR01196##

Into a 25-mL round-bottom flask was placed benzyl 4-(((1 S, R, 5R)-3-(5-cyclopropylisoxazole-3-carboxamido)-8-aza-bicyclo [3.2.1] octan-8-ylsulfonyl) methyl) piperidine-1-carboxylate (70 mg, 0.13 mmol, 1.00 equiv) and hydrochloric acid (12N, 3 mL). The resulting solution was stirred for 2 h at 25.degree. C. The residue was concentrated under vacuum. The crude product (32.9 mg) was purified by Flash-Prep-HPLC with the following conditions (IntelFlash-1): Column, silica gel; mobile phase: (phase A: 0.5% NH.sub.4HCO.sub.3 in H.sub.2O, phase B: CH.sub.3CN) B/A=5% increasing to B/A=80% within 15 min; Detector, UV 254 nm. This resulted in 14.4 mg (27%) of 5-cyclopropyl-N-((1S, 3R, 5R)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicyclo [3.2.1] octan-3-yl) isoxazole-3-carboxamide as a white solid. .sup.1H-NMR (400 MHz, CD.sub.3OD): .delta.6.48 (s, 1H), 4.56 (s, 2H), 4.20-4.16 (m, 1H), 3.34-3.02 (m, 4H), 2.66-2.59 (m, 2H), 2.31-1.92 (m, 12H), 1.34-1.30 (m, 2H), 1.18-1.13 (m, 2H), 1.01-0.97 (m, 2H) ppm. LCMS (method A, ESI): RT=1.36 min, m/z=423.3 [M+H].sup.+.

Example 19

Synthesis of N-((2S,4S)-1-(4-aminopiperidin-1-ylsulfonyl)-2-methylpiperidin-4-yl)-5-cy- clopropylisoxazole-3-carboxamide trifluoroacetic acid (Cpd. No. 529)

##STR01197##

Step 1: Synthesis of 1,4-dioxa-8-azaspiro[4.5]decane-8-sulfonyl chloride

##STR01198##

Into a 100-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed dichloromethane (30 mL) and sulfuryl chloride (5.1 g, 37.79 mmol, 1.08 equiv). This was followed by the addition of a solution of 1,4-dioxa-8-azaspiro[4.5]decane (5 g, 34.92 mmol, 1.00 equiv) and 4-dimethylaminopyridine (4.27 g, 34.95 mmol, 1.00 equiv) in dichloromethane (10 mL) dropwise with stirring at -78.degree. C. The resulting solution was stirred for 4 hours at 25.degree. C. The resulting mixture was concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:10). This resulted in 4.2 g (50%) of 1,4-dioxa-8-azaspiro[4.5]decane-8-sulfonyl chloride as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) .delta.: 4.02 (s, 4H), 3.51 (s, 4H), 1.94-1.91 (m, 4H) ppm.

Step 2: Synthesis of 5-cyclopropyl-N-[(2S,4S)-1-[1,4-dioxa-8-azaspiro[4.5]decane-8-sulfonyl]-2- -methylpiperidin-4-yl]-1,2-oxazole-3-carboxamide

##STR01199##

Into a 50-mL round-bottom flask was placed dichloromethane (15 mL), triethylamine (500 mg, 4.94 mmol, 4.71 equiv), and 5-cyclopropyl-N-[(2S,4S)-2-methylpiperidin-4-yl]-1,2-oxazole-3-carboxamid- e hydrochloride (300 mg, 1.05 mmol, 1.00 equiv). This was followed by the addition of a solution of 1,4-dioxa-8-azaspiro[4.5]decane-8-sulfonyl chloride (700 mg, 2.90 mmol, 2.76 equiv) in dichloromethane (5 mL) dropwise with stirring at -78.degree. C. The resulting solution was stirred for 16 hours at 25.degree. C. The reaction mixture was washed with brine (sat. aq., 3.times.10 mL) and the organic layer concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (3:7). This resulted in 300 mg (63%) of 5-cyclopropyl-N-[(2S,4S)-1-[1,4-dioxa-8-azaspiro[4.5]decane-8-sulfonyl]-2- -methylpiperidin-4-yl]-1,2-oxazole-3-carboxamide as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) .delta.: 6.82 (d, J=7.2 Hz, 1H), 6.34 (s, 1H), 4.24-4.22 (m, 1H), 3.98 (s, 4H), 3.73-3.70 (m, 1H), 3.63-3.60 (m, 1H), 3.35-3.27 (m, 5H), 2.11-2.00 (m, 3H), 1.80-1.73 (m, 6H), 1.45 (d, J=6.8 Hz, 3H), 1.16-1.12 (m, 2H), 1.02-0.98 (m, 2H) ppm. LCMS (method D, ESI): RT=1.91 min, m/z=455.5 [M+H].sup.+.

Step 3: Synthesis of 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(4-oxopiperidin-1-ylsulfonyl)piperidi- n-4-yl)isoxazole-3-carboxamide

##STR01200##

Into a 25-mL round-bottom flask was placed THF (10 mL), 5-cyclopropyl-N-[(2S,4S)-1-[1,4-dioxa-8-azaspiro[4.5]decane-8-sulfonyl]-2- -methylpiperidin-4-yl]-1,2-oxazole-3-carboxamide (300 mg, 0.66 mmol, 1.00 equiv) and hydrochloric acid (2N, 5 mL). The resulting solution was stirred for 16 hour at 25.degree. C. The pH value of the solution was adjusted to 8 with Na.sub.2CO.sub.3 (sat. aq.). The resulting mixture was concentrated under vacuum. The resulting mixture was diluted with 10 mL of DCM. The solids were filtered off yielding 250 mg (92%) of 5-cyclopropyl-N-[(2S,4S)-2-methyl-1-(4-oxopiperidine-1-sulfonyl)piperidin- -4-yl]-1,2-oxazole-3-carboxamide as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) .delta.: 6.83 (d, J=6.38 Hz, 1H), 6.34 (s, 1H), 4.26-4.24 (m, 1H), 3.72-3.66 (m, 2H), 3.59-3.56 (m, 4H), 3.34-3.32 (m, 1H), 2.60-2.56 (m, 4H), 2.11-2.04 (m, 3H), 1.82-1.76 (m, 2H), 1.48 (d, J=6.8 Hz, 3H), 1.15-1.12 (m, 2H), 1.02-1.00 (m, 2H) ppm. LCMS (method D, ESI): RT=1.32 min, m/z=411.2 [M+H].sup.+.

Step 4: Synthesis of N-((2S,4S)-1-(4-aminopiperidin-1-ylsulfonyl)-2-methylpiperidin-4-yl)-5-cy- clopropylisoxazole-3-carboxamide trifluoroacetic acid

##STR01201##

Into a 250-mL round-bottom flask was placed methanol (100 mL), 5-cyclopropyl-N-[(2S,4S)-2-methyl-1-(4-oxopiperidine-1-sulfonyl)piperidin- -4-yl]-1,2-oxazole-3-carboxamide (60 mg, 0.15 mmol, 1.00 equiv), and ammonium formate (500 mg, 7.93 mmol, 54.25 equiv). Then NaBH.sub.3CN (30 mg, 0.48 mmol, 3.27 equiv) was added at 0.degree. C. The resulting solution was stirred for 16 hours at 25.degree. C. The reaction mixture was concentrated under vacuum and the residue diluted with 20 mL of dichloromethane. The resulting mixture was washed with brine (sat. aq., 2.times.10 mL). The organic layer was concentrated under vacuum and the crude product purified by Prep-HPLC with the following conditions (1#-Pre-HPLC-005(Waters)): Column, Atlantis Prep OBD T3 Column, 19*150 mm, 5 um, mobile phase, water with 0.05% TFA and CH.sub.3CN (up to 3.0% in 10 min, up to 100.0% in 1 min, hold 100.0% in 1 min); Detector, UV 254 nm. This resulted in 26.4 mg (34%) of N-[(2S,4S)-1-(4-aminopiperidine-1-sulfonyl)-2-methylpiperidin-4-yl]-5-cyc- lopropyl-1,2-oxazole-3-carboxamide trifluoroacetate as a white solid. .sup.1H NMR (400 MHz, CD.sub.3OD) .delta.: 6.38 (s, 1H), 4.13-4.05 (m, 1H), 3.80-3.77 (m, 3H), 3.76-3.74 (m, 1H), 3.33-3.23 (m, 2H), 2.93 (t, J=12.4 Hz, 2H), 2.19-2.15 (m, 1H), 2.07-1.95 (m, 4H), 1.82-1.67 (m, 4H), 1.42 (d, J=6.8 Hz, 3H), 1.18-1.13 (m, 2H), 1.00-0.97 (m, 2H) ppm. LCMS (method A, ESI): RT=1.71 min, m/z=412.5 [M-TFA+H].sup.+.

Example 20

Synthesis of N-((2S,4S)-1-(4-(2-aminopropan-2-yl)phenylsulfonyl)-2-methylpiperidin-4-y- l)-5-cyclopropylisoxazole-3-carboxamide (Cpd. No. 541)

##STR01202##

Step 1: Synthesis of N-((2S,4S)-1-(4-bromophenylsulfonyl)-2-methylpiperidin-4-yl)-5-cyclopropy- lisoxazole-3-carboxamide

##STR01203##

Into a 100-mL round-bottom flask was placed 5-cyclopropyl-N-[(2S,4S)-2-methylpiperidin-4-yl]-1,2-oxazole-3-carboxamid- e hydrochloride (1 g, 3.50 mmol, 1.00 equiv) and dichloromethane (10 mL). This was followed by the dropwise addition of TEA (1.1 g, 10.87 mmol, 3.11 equiv) with stirring at 0.degree. C. To this was added 4-bromobenzene-1-sulfonyl chloride (900 mg, 3.52 mmol, 1.01 equiv) in several batches at 0.degree. C. The resulting solution was stirred at room temperature for overnight. The reaction mixture was diluted with 10 mL of H.sub.2O and extracted with 3.times.20 mL of dichloromethane. Theorganic layers were combined and dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:10-1:2). This resulted in 1.6 g (98%) of N-((2S,4S)-1-(4-bromophenylsulfonyl)-2-methylpiperidin-4-yl)-5-cyclopropy- lisoxazole-3-carboxamide as a white solid. .sup.1H-NMR (400 MHz, CDCl.sub.3): .delta. 7.75-7.64 (m, 4H), 6.75 (d, J=6.4 Hz, 1H), 6.32 (s, 1H), 4.17-4.03 (m, 1H), 3.80-3.69 (m, 1H), 3.67-3.53 (m, 1H), 3.30-3.18 (m, 1H), 2.12-2.03 (m, 1H), 2.03-1.92 (m, 2H), 1.82-1.66 (m, 2H), 1.33 (d, J=6.8 Hz, 3H), 1.19-1.09 (m, 2H), 1.03-0.95 (m, 2H) ppm. LCMS (Method A, ESI): RT=1.54 min, m/z=468.0 [M+H].sup.+.

Step 2: Synthesis of 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(4-(prop-1-en-2-yl)phenylsulfonyl)pip- eridin-4-yl)isoxazole-3-carboxamide

##STR01204##

Into a 50-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed N-((2S,4S)-1-(4-bromophenylsulfonyl)-2-methylpiperidin-4-yl)-5-cyclopropy- lisoxazole-3-carboxamide (1 g, 2.14 mmol, 1.00 equiv), Pd(dppf)Cl.sub.2 (160 mg, 0.22 mmol, 0.10 equiv), K.sub.2CO.sub.3 (880 mg, 6.32 mmol, 2.96 equiv), 4,4,5,5-tetramethyl-2-(prop-1-en-2-yl)-1,3,2-dioxaborolane (540 mg, 3.21 mmol, 1.51 equiv), 1,4-dioxane (10 mL) and water (1 mL). The resulting solution was stirred at 90.degree. C. overnight. The reaction mixture was diluted with 10 mL of H.sub.2O and extracted with 3.times.50 mL of ethyl acetate. Theorganic layers were combined and dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:10-1:2). This resulted in 480 mg (52%) of 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(4-(prop-1-en-2-yl)phenylsulfonyl)pip- eridin-4-yl)isoxazole-3-carboxamide as a light yellow solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 7.76 (d, J=8.7 Hz, 2H), 7.58 (d, J=8.7 Hz, 2H), 6.73 (d, J=6.6 Hz, 1H), 6.30 (s, 1H), 5.48 (s, 1H), 5.24 (s, 1H), 4.17-3.98 (m, 1H), 3.81-3.68 (m, 1H), 3.61-3.47 (m, 1H), 3.28-3.12 (m, 1H), 2.18 (s, 3H), 2.11-1.92 (m, 3H), 1.79-1.60 (m, 2H), 1.33 (d, J=6.6 Hz, 3H), 1.16-1.05 (m, 2H), 1.02-0.91 (m, 2H) ppm. LCMS (Method D, ESI): RT=1.61 min, m/z=430.0 [M+H].sup.+.

Step 3: Synthesis of N-((2S,4S)-1-(4-(2-(2-chloroacetamido)propan-2-yl)phenylsulfonyl)-2-methy- lpiperidin-4-yl)-5-cyclopropylisoxazole-3-carboxamide

##STR01205##

Into a 100-mL round-bottom flask was placed 5-cyclopropyl-N-((2S,4S)-2-methyl-1-(4-(prop-1-en-2-yl)phenylsulfonyl)pip- eridin-4-yl)isoxazole-3-carboxamide (480 mg, 1.12 mmol, 1.00 equiv), 2-chloroacetonitrile (1.67 g, 22.12 mmol, 19.79 equiv), and acetic acid (28 mL). After cooling to 0.degree. C. sulfuric acid (98%, 7 mL) was added dropwise. The resulting solution was stirred at room temperature overnight. The reaction mixture was diluted with of ice-water and the pH of the solution was adjusted to 7 with sodium carbonate (sat. aq.). The resulting solution was extracted with 3.times.50 mL of dichloromethane and the organic layers combined and dried over anhydrous sodium sulfate. The residue was chromatographed on a silica gel column with dichloromethane/methanol (20:1). This resulted in 580 mg (99%) of N-((2S,4S)-1-(4-(2-(2-chloroacetamido)propan-2-yl)phenylsulfonyl)-2-methy- lpiperidin-4-yl)-5-cyclopropylisoxazole-3-carboxamide as a white solid. .sup.1H-NMR (300 MHz, CD.sub.3OD): .delta. 7.78 (d, J=8.7 Hz, 2H), 7.62 (d, J=8.7 Hz, 2H), 6.34 (s, 1H), 4.09-3.99 (m, 3H), 3.95-3.80 (m, 2H), 3.17-3.00 (m, 1H), 2.20-2.08 (m, 1H), 2.03-1.79 (m, 2H), 1.77-1.56 (m, 8H), 1.33 (d, J=6.6 Hz, 3H), 1.19-1.09 (m, 2H), 1.00-0.91 (m, 2H) ppm. LCMS (Method D, ESI): RT=0.97 min, m/z=523.0 [M+H].sup.+.

Step 4: Synthesis of N-((2S,4S)-1-(4-(2-aminopropan-2-yl)phenylsulfonyl)-2-methylpiperidin-4-y- l)-5-cyclopropylisoxazole-3-carboxamide

##STR01206##

Into a 25-mL round-bottom flask was placed N-((2S,4S)-1-(4-(2-(2-chloroacetamido)propan-2-yl)phenylsulfonyl)-2-methy- lpiperidin-4-yl)-5-cyclopropylisoxazole-3-carboxamide (150 mg, 0.29 mmol, 1.00 equiv), acetic acid (0.3 mL), ethanol (1.5 mL) and thiourea (26 mg, 0.34 mmol, 1.19 equiv). The resulting solution was stirred at 85.degree. C. overnight. The reaction mixture was concentrated under vacuum and the residue diluted with 10 mL of H.sub.2O. The resulting solution was extracted with 3.times.5 mL of ethyl acetate and the organic layers combined. The combined extracts were concentrated under vacuum and the crude product (98 mg) was purified by Prep-HPLC with the following conditions: Column: X Bridge C18, 19*150 mm, 5 um; Mobile Phase A: Water/10 mmol/L NH.sub.4HCO.sub.3, Mobile Phase B: MeOH; Flow rate: 30 mL/min; Gradient: 45% B to 75% B in 06 min; 254 nm. 100 mL product was obtained. This resulted in 24 mg (19%) of N-((2S,4S)-1-(4-(2-aminopropan-2-yl)phenylsulfonyl)-2-methylpiperidin-4-y- l)-5-cyclopropylisoxazole-3-carboxamide as a white solid. .sup.1H-NMR (400 MHz, CD.sub.3OD): .delta. 7.85-7.71 (m, 4H), 6.35 (s, 1H), 3.92-3.80 (m, 2H), 3.41-3.33 (m, 1H), 3.16-3.07 (m, 1H), 2.21-2.10 (m, 1H), 2.00-1.91 (m, 1H), 1.91-1.82 (m, 1H), 1.76-1.62 (m, 2H), 1.54 (s, 6H), 1.34 (d, J=6.4 Hz, 3H), 1.19-1.09 (m, 2H), 1.00-0.91 (m, 2H) ppm. LCMS (Method B, ESI): RT=1.71 min, m/z=447.0 [M+H].sup.+.

Example 21

Synthesis of 5-cyclopropyl-N-[(1R,3r,5S)-8-([[1-(4,4,4-trifluorobutyl)piperidin-4-yl]m- ethane]sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-1,2-oxazole-3-carboxamide (Cpd. No. 528)

##STR01207##

Into a 50-mL 3-necked round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed 5-cyclopropyl-N-[(1R,3R,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-azabicy- clo[3.2.1]octan-3-yl]-1,2-oxazole-3-carboxamide (68 mg, 0.16 mmol, 1.00 equiv), methanol (2 mL), and 4,4,4-trifluorobutanal (41 mg, 0.33 mmol, 2.00 equiv). Then NaBH.sub.3CN (51 mg, 5.00 equiv) was added at 0.degree. C. The resulting solution was stirred for 6 h at room temperature. The reaction mixture was concentrated under vacuum. The residue was dissolved in DCM (10 mL) and washed with saturated brine (10 mL). The organic phase was collected and concentrated under vacuum. The crude product was purified by Prep-HPLC with the following conditions (Prep-HPLC-019): Column, XBridge Prep C18 OBD Column, 19*100 mm 5 um 13 nm; mobile phase, Water with 10 mmolNH.sub.4HCO.sub.3 and MeCN (30.0% MeCN up to 60.0% in 6 min); Detector, UV 254/220 nm. This resulted in 23.6 mg (28%) of 5-cyclopropyl-N-[(1R,3R,5S)-8-([[1-(4,4,4-trifluorobutyl)piperidin-4-yl]m- ethane]sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-1,2-oxazole-3-carboxamide as a white solid. .sup.1H-NMR (400 MHz, CD.sub.3OD): 6.39 (s, 1H), 4.25 (s, 2H), 4.17 (t, J=6.8 Hz, 1H), 3.07 (d, J=5.6 Hz, 2H), 2.96 (d, J=11.6 Hz, 2H), 2.43 (t, J=7.6 Hz, 2H), 2.31-1.97 (m, 16H), 1.81-1.74 (m, 2H), 1.46 (q, J=12.4 Hz, 2H), 1.18-1.13 (m, 2H), 1.00-0.95 (m, 2H) ppm. LCMS (method A, ESI): RT=1.52 min, m/z=533.4 [M+H].sup.+.

Example 22

Synthesis of N-((2S,4S)-1-(3,8-diaza-bicyclo[3.2.1]octan-8-ylsulfonyl)-2-methylpiperid- in-4-yl)-5-cyclopropylisoxazole-3-carboxamide (Cpd. No. 555)

##STR01208##

Step 1: Synthesis of (2S,4S)-4-(5-cyclopropylisoxazole-3-carboxamido)-2-methylpiperidine-1-sul- fonyl chloride

##STR01209##

Into a 100-mL 3-necked round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed solution of sulfuryl chloride (242 mg, 1.79 mmol, 1.50 equiv) in dichloromethane (10 mL) at -70.degree. C. To this was added a solution of DIEA (621 mg, 4.81 mmol, 4.00 equiv) and 5-cyclopropyl-N-(3-methylpiperazin-1-yl)-1,2-oxazole-3-carboxamide (300 mg, 1.20 mmol, 1.00 equiv) in dichloromethane (5 mL) dropwise with stirring at -70.degree. C. The resulting solution was stirred for 30 min at -70.degree. C. in a dry ice bath. The reaction mixture was concentrated under vacuum and the residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:4). The fractions containing product were combined and concentrated under vacuum. This resulted in 350 mg (84%) of 4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperazine-1-sulfonyl chloride as a white solid. LCMS (method D, ESI): RT=0.98 min, m/z=348 [M+H].sup.+.

Step 2: Synthesis of tert-butyl 8-((2S,4S)-4-(5-cyclopropylisoxazole-3-carboxamido)-2-methylpiperidin-1-y- lsulfonyl)-3,8-diaza-bicyclo[3.2.1]octane-3-carboxylate

##STR01210##

Into a 50-mL round-bottom flask was placed tert-butyl 3,8-diazabicyclo[3.2.1]octane-3-carboxylate (366.6 mg, 1.73 mmol, 1.50 equiv), dichloromethane (20 mL), DIEA (298 mg, 2.31 mmol, 2.00 equiv), and 4-dimethylaminopyridine (14 mg, 0.11 mmol, 0.10 equiv). To this was added a solution of (2S,4S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-sulfon- yl chloride (400 mg, 1.15 mmol, 1.00 equiv) in dichloromethane (2 mL) dropwise with stirring at 0.degree. C. under nitrogen. The resulting solution was stirred overnight at room temperature. After concentration, the residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1/10-1/5). This resulted in 550 mg (91%) of tert-butyl 8-[(2S,4S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-sul- fonyl]-3,8-diazabicyclo[3.2.1]octane-3-carboxylate as colorless oil. LCMS (method D, ESI): RT=1.26 min, m/z=524.3 [M+H].sup.+.

Step 3: Synthesis of 5-cyclopropyl-N-[(2S,4S)-1-[3,8-diazabicyclo[3.2.1]octane-8-sulfonyl]-2-m- ethylpiperidin-4-yl]-1,2-oxazole-3-carboxamide

##STR01211##

Into a 50-mL round-bottom flask was placed tert-butyl 8-[(2S,4S)-4-(5-cyclopropyl-1,2-oxazole-3-amido)-2-methylpiperidine-1-sul- fonyl]-3,8-diazabicyclo[3.2.1]octane-3-carboxylate (550 mg, 1.05 mmol, 1.00 equiv), dichloromethane (20 mL) and trifluoroacetic acid (4 mL). The resulting solution was stirred for 2.5 h at room temperature. The reaction mixture was concentrated under vacuum. The crude product was purified by Prep-HPLC with the following conditions: Column, Sunfire C18 19*150, mobile phase, CH.sub.3CN:NH.sub.4CO.sub.3/H.sub.2O (10 mmol/L)=20%-55%, 20 min, Detector UV 254 nm. This resulted in 355.4 mg (80%) of 5-cyclopropyl-N-[(2S,4S)-1-[3,8-diazabicyclo[3.2.1]octane-8-sulf- onyl]-2-methylpiperidin-4-yl]-1,2-oxazole-3-carboxamide as a white solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 6.90-6.71 (m, 1H), 6.32 (s, 1H), 4.28-4.15 (m, 1H), 3.78-3.68 (m, 1H), 3.67-3.50 (m, 3H), 3.4-3.28 (m, 2H), 3.27-3.15 (m, 1H), 3.10-3.00 (m, 2H), 2.20-2.00 (m, 4H), 1.89-1.69 (m, 6H), 1.50-1.39 (m, 3H), 1.20-1.06 (m, 2H), 1.05-0.90 (m, 2H) ppm. LCMS (method A, ESI): RT=1.73 min, m/z=424.0 [M+H].sup.+.

Example 23

Synthesis of N-((1R,3R,5S)-8-((1r,4R)-4-aminocyclohexylsulfonyl)-8-aza-bicyclo[3.2.1]o- ctan-3-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride

(Cpd. No. 539)

##STR01212##

Step 1: Synthesis of 5-cyclopropyl-N-((1R,3r,5S)-8-(4-oxocyclohexylsulfonyl)-8-aza-bicyclo[3.2- .1]octan-3-yl)isoxazole-3-carboxamide

##STR01213##

Into a 2-L 3-necked round-bottom flask was placed a solution of N-((1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-car- boxamide hydrochloride (20 g, 67.16 mmol, 1.00 equiv) in dichloromethane (800 mL). Then DIEA (43 g, 332.71 mmol, 5.00 equiv) was added, followed by the addition of 4-oxocyclohexane-1-sulfonyl chloride (14.45 g, 73.48 mmol, 1.10 equiv) in portions over 5.5 hr (0.1 equiv for each portion). The resulting solution was stirred overnight at 20.degree. C. The reaction mixture was washed with dilute hydrochloric acid (1N, 200 mL). Then the organic phase was washed with NaHCO.sub.3 (sat. 200 mL) and brine (sat. 200 mL) respectively. The organic phase was dried over anhydrous Na.sub.2SO.sub.4 and concentrated under vacuum. This resulted in 19 g (64%) of 5-cyclopropyl-N-((1R,3r,5S)-8-(4-oxocyclohexylsulfonyl)-8-aza-bicyclo[3.2- .1]octan-3-yl)isoxazole-3-carboxamide as a yellow solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 7.14 (d, J=9 Hz, 1H), 6.34 (s, 1H), 4.37-4.25 (m, 3H), 3.36-3.27 (m, 1H), 2.65-2.15 (m, 10H), 2.13-1.9 (m, 7H), 1.20-1.10 (m, 2H), 1.05-0.95 (m, 2H) ppm. LCMS (method C, ESI): RT=0.88 min, m/z=422.2 [M+H].sup.+.

Step 2: Synthesis of N-((1R,3R,5S)-8-(((1r,4R)-4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]- octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride

##STR01214##

Into a 5-L round-bottom flask was placed a solution of 5-cyclopropyl-N-((1R,3r,5S)-8-(4-oxocyclohexylsulfonyl)-8-aza-bicyclo[3.2- .1]octan-3-yl)isoxazole-3-carboxamide (3 g, 7.12 mmol, 1.00 equiv) in methanol (3 L), then HCOONH.sub.4 (17.6 g, 279.12 mmol, 40.00 equiv) and acetic acid (852 mg, 14.19 mmol, 2.00 equiv) were added. After stirred for 30 min at 25.degree. C., NaBH.sub.3CN (895 mg, 14.24 mmol, 2.00 equiv) was added portion-wise. The resulting solution was stirred for 30 min at 25.degree. C. The reaction mixture was concentrated under vacuum. The resulting solid was extracted with ethyl acetate (100 mL.times.5). The combined organic extracts were concentrated and the residue purified by flash chromatography (DCE:MeOH=10:1). The crude product was further purified by Prep-HPLC with the following conditions: Column, X Bridge C18, 19*150 mm, 5 um; mobile phase, Mobile Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 20 mL/min; Detector, 254 nm. The fractions containing product were combined and concentrated. They were then treated with hydrochloric acid (12N, 1 mL) and concentrated again under vacuum. This resulted in 1.0 g (31%) of N-((1R,3R,5S)-8-((1r,4R)-4-aminocyclohexylsulfonyl)-8-aza-bicyclo[3.2.1]o- ctan-3-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride as a light yellow solid. .sup.1H-NMR (300 MHz, D.sub.2O): .delta. 6.29 (s, 1H), 4.21-4.00 (m, 3H), 3.28-3.10 (m, 2H), 2.30-2.05 (m, 7H), 2.05-1.87 (m, 6H), 1.65-1.35 (m, 4H), 1.12-1.00 (m, 2H), 0.95-0.84 (m, 2H) ppm. LCMS (method D, ESI): RT=0.89 min, m/z=423.1 [M+H].sup.+.

Example 24

Synthesis of N-((1R,3r,5S)-8-(4-aminopiperidin-1-ylsulfonyl)-8-aza-bicyclo[3.2.1]octan- -3-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride (Cpd. No. 532)

##STR01215##

Step 1: Synthesis of tert-butyl 1-((1R,3r,5S)-3-(5-cyclopropylisoxazole-3-carboxamido)-8-aza-bicyclo[3.2.- 1]octan-8-ylsulfonyl)piperidin-4-ylcarbamate

##STR01216##

Into a 250-mL round-bottom flask was placed tert-butyl N-(piperidin-4-yl)carbamate (1.2 g, 5.99 mmol, 4.00 equiv), dichloromethane (20 mL), and DIEA (2.2 g, 17.02 mmol, 10.00 equiv). After stirring for 30 min, (1R,3r,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]octan- e-8-sulfonyl chloride (600 mg, 1.67 mmol, 1.00 equiv) was added at 0.degree. C. The resulting solution was stirred for 12 h at 20.degree. C. The reaction mixture was diluted by DCM (30 mL), and washed by water (10 mL.times.3). The organic extract was dried over anhydrous sodium sulfate and concentrated under reduced pressure. The residue was chromatographed on a silica gel column with ethyl acetate/hexane (2:1). This resulted in 620 mg (71%) of tert-butyl 1-((1R,3r,5S)-3-(5-cyclopropylisoxazole-3-carboxamido)-8-aza-bicyclo[3.2.- 1]octan-8-ylsulfonyl)piperidin-4-ylcarbamate. .sup.1H-NMR (400 MHz, CDCl.sub.3): .delta. 7.15 (d, J=7.2 Hz, 1H), 6.35 (s, 1H), 4.50-4.45 (m, 1H), 4.36-4.28 (m, 1H), 4.20-4.10 (m, 2H), 3.75-3.50 (m, 3H), 2.90-2.80 (m, 2H), 2.35-2.22 (m, 4H), 2.15-1.89 (m, 7H), 1.55-1.43 (m, 11H), 1.18-1.12 (m, 2H), 1.04-0.96 (m, 2H) ppm. LCMS (method A, ESI): RT=1.45 min, m/z=546.0 [M+23]'.

Step 2: Synthesis of N-((1R,3r,5S)-8-(4-aminopiperidin-1-ylsulfonyl)-8-aza-bicyclo[3.2.1]octan- -3-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride

##STR01217##

Into a 250-mL round-bottom flask was placed tert-butyl N-[1-[(1R,3r,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1- ]octane-8-sulfonyl]piperidin-4-yl]carbamate (600 mg, 1.15 mmol, 1.00 equiv) and dichloromethane (20 mL). Then hydrogen chloride (gas) was introduced into mixture. The resulting solution was stirred for 5 h at 20.degree. C. The resulting mixture was concentrated under vacuum. The solids were collected by filtration. This resulted in 420 mg (87%) of N-((1R,3r,5S)-8-(4-aminopiperidin-1-ylsulfonyl)-8-aza-bicyclo[3.2.1]octan- -3-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride as a white solid. .sup.1H-NMR (300 MHz, D.sub.2O): .delta. 6.31 (s, 1H), 4.09 (s, 3H), 3.76 (d, J=9 Hz, 2H), 3.39-3.26 (m, 1H), 2.97-2.84 (m, 2H), 2.30-1.90 (m, 11H), 1.74-1.56 (m, 2H), 1.15-1.02 (m, 2H), 0.96-0.86 (m, 2H) ppm. LCMS (method B, ESI): RT=1.50 min, m/z=423.9 [M+H].sup.+.

Example 25

Synthesis of N-((1R,3r,5S)-8-(2,7-diazaspiro[3.5]nonan-2-ylsulfonyl)-8-azabicyclo[3.2.- 1]octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide 2,2,2-trifluoroacetate (Cpd. No. 559)

##STR01218##

Step 1: Synthesis of (1R,3r,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]octan- e-8-sulfonyl chloride

##STR01219##

Into a 250-mL 3-necked round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed sulfuryl chloride (451 mg, 3.34 mmol, 1.00 equiv). At -78.degree. C., DIEA (870 mg, 6.73 mmol, 2.00 equiv) with N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-5-cyclopropyl-1,2-oxazole-3-- carboxamide hydrochloride (1 g, 3.36 mmol, 1.00 equiv) in dichloromethane (50 mL) was added dropwise into the above solution at -78.degree. C. (in a liquid nitrogen bath) in 5 min. The resulting solution was allowed to warm to room temperature and stir overnight. The reaction mixture was concentrated under vacuum. The residue was dissolved in 40 ml of ethyl acetate. The resulting mixture was washed with 50 mL of diluted hydrochloric acid (1N). Then the mixture was dried over anhydrous sodium sulfate and concentrated under vacuum. This resulted in 1 g (83%) of (1R,3r,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]octan- e-8-sulfonyl chloride as a white solid. .sup.1H-NMR (300 MHz, CD.sub.3OD): .delta. 6.36 (s, 1H), 4.45 (s, 2H), 4.17 (t, J=12 Hz, 1H), 2.50-2.02 (m, 9H), 1.17-1.09 (m, 2H), 1.00-0.91 (m, 2H) ppm. LCMS (method A, ESI): RT=1.45 min, m/z=360.0 [M+H].sup.+.

Step 2: Synthesis of tert-butyl 2-[(1R,3r,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]oc- tane-8-sulfonyl]-2,7-diazaspiro[3.5]nonane-7-carboxylate

##STR01220##

Into a 50-mL round-bottom flask was placed tert-butyl 2,7-diazaspiro[3.5]nonane-7-carboxylate hydrochloride (876 mg, 3.33 mmol, 4.14 equiv), DIEA (1.07 mg, 0.01 mmol, 0.01 equiv), and dichloromethane (5 mL). After the mixture was stirred for 30 min, (1R,3r,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]octan- e-8-sulfonyl chloride (290 mg, 0.81 mmol, 1.00 equiv) was added. The resulting solution was stirred for 12 h at 20.degree. C. The reaction mixture was diluted with 30 mL of dichloromethane and washed with water (10 mL.times.3). The organic phase was dried over anhydrous Na.sub.2SO.sub.4 and concentrated under reduced pressure. The residue was chromatographed on a silica gel column with ethyl acetate/hexane (2:1). This resulted in 355 mg (75%) of tert-butyl 2-[(1R,3r,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]oc- tane-8-sulfonyl]-2,7-diazaspiro[3.5]nonane-7-carboxylate as a white solid. .sup.1H-NMR (400 MHz, CDCl.sub.3): .delta. 7.12 (d, 1H), 6.32 (s, 1H), 4.35-4.15 (m, 3H), 3.60 (s, 4H), 3.35 (t, J=12 Hz, 4H), 2.35-1.85 (m, 9H), 1.74 (t, J=12 Hz, 4H), 1.45 (s, 9H), 1.17-1.08 (m, 2H), 1.03-0.96 (m, 2H) ppm. LCMS (method B, ESI): RT=1.52 min, m/z=450.2 [M-100].sup.+.

Step 3: Synthesis of 5-cyclopropyl-N-[(1R,3r,5S)-8-[2,7-diazaspiro[3.5]nonane-2-sulfonyl]-8-az- abicyclo[3.2.1]octan-3-yl]-1,2-oxazole-3-carboxamide trifluoroacetate

##STR01221##

Into a 25-mL round-bottom flask was placed tert-butyl 2-[(1R,3r,5S)-3-(5-cyclopropyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]oc- tane-8-sulfonyl]-2,7-diazaspiro[3.5]nonane-7-carboxylate (50 mg, 0.09 mmol, 1.00 equiv), dichloromethane (10 mL) and trifluoroacetic acid (2.5 mL). The resulting solution was stirred for 4 h at room temperature. The reaction mixture was concentrated under vacuum. The crude product was purified by Prep-HPLC with the following conditions: Column: X Bridge C18, 19*150 mm, 5 um; Mobile Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 20 mL/min; Gradient: 30% B to 70% B in 10 min; 254 nm. This resulted in 36.5 mg (83%) of 5-cyclopropyl-N-[(1R,3r,5S)-8-[2,7-diazaspiro[3.5]nonane-2-sulfonyl]-8-az- abicyclo[3.2.1]octan-3-yl]-1,2-oxazole-3-carboxamide trifluoroacetate as a solid. .sup.1H-NMR (300 MHz, D.sub.2O): .delta. 6.28 (s, 1H), 4.08 (s, 3H), 3.66 (s, 4H), 3.15-3.05 (m, 4H), 2.24-1.86 (m, 13H), 1.08-099 (m, 2H), 0.92-0.84 (m, 2H) ppm. LCMS (method B, ESI): RT=1.67 min, m/z=450.0 [M+H].sup.+.

Example 26

Synthesis of 5-ethyl-N-((1R,3r,5S)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicyclo[3.2.- 1]octan-3-yl)isoxazole-3-carboxamide (Cpd. No. 562)

##STR01222##

Step 1: Synthesis of ethyl 5-ethylisoxazole-3-carboxylate

##STR01223##

Into a 250-mL round-bottom flask was placed ethyl 2,4-dioxohexanoate (10 g, 69.36 mmol, 1.00 equiv), ethanol (100 mL), and NH.sub.2OH--HCl (4.95 g, 70.23 mmol, 1.2 equiv). The resulting solution was stirred for 16 hours at 80.degree. C. in an oil bath. The reaction mixture was concentrated under vacuum and the residue dissolved in 50 mL of ethyl acetate. The resulting mixture was washed with 2.times.20 mL of water. The organic phase was dried and concentrated under vacuum. This resulted in 10 g (46%) of ethyl 5-ethyl-1,2-oxazole-3-carboxylate as a yellow solid. LCMS (method A, ESI): RT=1.37 min, m/z=170.0 [M+H].sup.+.

Step 2: Synthesis of 5-ethylisoxazole-3-carboxylic acid

##STR01224##

Into a 250-mL round-bottom flask was placed ethyl 5-ethyl-1,2-oxazole-3-carboxylate (5 g, 29.55 mmol, 1.00 equiv), ethanol (50 mL), and sodium hydroxide (2.4 g, 60.00 mmol, 2.03 equiv). This was followed by the addition of water (8 mL) dropwise with stirring over 10 mins. The resulting solution was stirred for 16 hours at 25.degree. C. The pH value of the solution was adjusted to 4 with hydrochloric acid (6N). The resulting solution was extracted with 50 mL of dichloromethane. The resulting mixture was concentrated under vacuum. This resulted in 3 g (72%) of 5-ethyl-1,2-oxazole-3-carboxylic acid as a yellow solid. .sup.1H-NMR (300 MHz, DMSO): .delta.13.8 (s, 1H), 6.58 (s, 1H), 2.85 (q, J.sub.1=7.5 Hz, 2H), 1.32 (t, J=7.5 Hz, 3H) ppm. LCMS (method C, ESI): RT=2.60 min, m/z=142.0411.0 [M+H].sup.+.

Step 3: Synthesis of (1R,3r,5S)-tert-butyl 3-(5-ethylisoxazole-3-carboxamido)-8-azabicyclo[3.2.1]octane-8-carboxylat- e

##STR01225##

Into a 50-mL round-bottom flask was placed (1R,3r,5S)-tert-butyl 3-amino-8-azabicyclo[3.2.1]octane-8-carboxylate (300 mg, 1.33 mmol, 1.00 equiv), dichloromethane (13 mL), 5-ethyl-1,2-oxazole-3-carboxylic acid (480 mg, 3.40 mmol, 1.10 equiv), 1-hydroxybenzotrizole (431 mg, 3.19 mmol, 1.50 equiv), N-(3-dimethylaminopropyl)-N'-ethylcarbodiimide hydrochloride (1.2 g, 6.26 mmol, 3.00 equiv) and triethylamine (860 mg, 8.50 mmol, 4.00 equiv). The resulting solution was stirred for 16 h at 25.degree. C. The reaction mixture was washed with 2.times.30 mL of H.sub.2O. The water layers were back extracted with 2.times.30 mL of dichloromethane and the organic layers combined and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (6:1). This resulted in 350 mg (76%) of (1R,3r,5S)-tert-butyl 3-(5-ethylisoxazole-3-carboxamido)-8-azabicyclo[3.2.1]octane-8-carboxylat- eas a yellow solid. LCMS (method C, ESI): RT=0.93 min, m/z=350.0 [M+H].sup.+.

Step 4: Synthesis of N-((1R,3r,5S)-8-aza-bicyclo[3.2.1]octan-3-yl)-5-ethylisoxazole-3-carboxam- ide

##STR01226##

Into a 50-mL round-bottom flask was placed (1R,3r,5S)-tert-butyl 3-(5-ethylisoxazole-3-carboxamido)-8-azabicyclo[3.2.1]octane-8-carboxylat- e (350 mg, 1.00 mmol, 1.00 equiv) and dichloromethane (30 mL). To the above hydrogen chloride (gas) was introduced. The resulting solution was stirred for 2 h at 25.degree. C. The reaction mixture was concentrated under vacuum. This resulted in 300 mg (HCl salt) of N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-5-ethyl-1,2-oxazole-3-carbox- amide as a white solid. LCMS (method A, ESI): RT=0.97 min, m/z=250.0 [M+H].sup.+.

Step 5: Synthesis of benzyl 4-(((1R,3r,5S)-3-(5-ethylisoxazole-3-carboxamido)-8-aza-bicyclo[3.2.1]oct- an-8-ylsulfonyl)methyl)piperidine-1-carboxylate

##STR01227##

Into a 25-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-5-ethyl-1,2-oxazole-3-carbox- amide (100 mg, 0.40 mmol, 1.00 equiv), and tetrahydrofuran (5 mL). This was followed by the addition of lithium bis(trimethylsilyl)amide (1N in THF, 1.5 mL) dropwise with stirring at -70.degree. C. To this was added benzyl 4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (200 mg, 0.60 mmol, 1.50 equiv) in several portions at -70.degree. C. The resulting solution was stirred for 30 min at -70.degree. C. in a dry ice bath. The reaction mixture was stirred for an additional 16 h at 25.degree. C. The resulting solution was diluted with 30 mL of ethyl acetate and washed with 2.times.15 mL of H.sub.2O. The resulting mixture was concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (2:3). This resulted in 140 mg (64%) of benzyl 4-[[(1R,3r,5S)-3-(5-ethyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]- octane-8-sulfonyl]methyl]piperidine-1-carboxylate as white solid. LCMS (method C, ESI): RT=1.53 min, m/z=545.0 [M+H].sup.+.

Step 6: Synthesis of 5-ethyl-N-((1R,3r,5S)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicyclo[3.2.- 1]octan-3-yl)isoxazole-3-carboxamide

##STR01228##

Into a 50-mL round-bottom flask was placed benzyl 4-[[(1R,3r,5S)-3-(5-ethyl-1,2-oxazole-3-amido)-8-azabicyclo[3.2.1]octane-- 8-sulfonyl]methyl]piperidine-1-carboxylate (120 mg, 0.22 mmol, 1.00 equiv) and hydrochloric acid (12N, 20 mL). The resulting solution was stirred for 2 h at 25.degree. C. The reaction mixture was concentrated under vacuum. The crude product (120 mg) was purified by Prep-HPLC with the following conditions (Prep-HPLC-025): Column, XBridge Prep Phenyl OBD Column, 5 um, 19*150 mm; mobile phase, Water with 10 mmol NH.sub.4HCO.sub.3 and MeCN (20.0% MeCN up to 75.0% in 10 min, up to 95.0% in 1 min, hold 95.0% in 1 min, down to 20.0% in 2 min); Detector, UV 254/220 nm. This resulted in 34.8 mg (38%) of 5-ethyl-N-[(1R,3r,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-azabicyclo[3.- 2.1]octan-3-yl]-1,2-oxazole-3-carboxamide as a white solid. .sup.1H-NMR (400 MHz, CD.sub.3OD): .delta. 6.47 (s, 1H), 4.26 (d, J=23.0 Hz, 2H), 4.16 (d, J=6.4 Hz, 1H), 3.14-3.06 (m, 4H), 2.89 (q, J.sub.1=7.6 Hz, J.sub.2.sup.=15.2 Hz, 2H), 2.76 (q, J.sub.1=10.8 Hz, J.sub.2=12.8 Hz, 2H), 2.32-2.26 (m, 2H), 2.10-1.91 (m, 9H), 1.44-1.38 (m, 5H) ppm. LCMS (method C, ESI): RT=2.60 min, m/z=411.0 [M+H].sup.+.

Example 27

Synthesis of N-((1R,3r,5S)-8-((1s,4S)-4-aminocyclohexylsulfonyl)-8-aza-bicyclo[3.2.1]o- ctan-3-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride (Cpd. No. 540)

##STR01229##

Into a 5-L round-bottom flask was placed a solution of 5-cyclopropyl-N-((1R,3r,5S)-8-((4-oxocyclohexyl)sulfonyl)-8-azabicyclo[3.- 2.1]octan-3-yl)isoxazole-3-carboxamide (3 g, 7.12 mmol, 1.00 equiv) in methanol (3 L). Then HCOONH.sub.4 (17.6 g, 279.12 mmol, 40.00 equiv) and acetic acid (852 mg, 14.19 mmol, 2.00 equiv) were added. After stirring for 30 min at 25.degree. C., NaBH.sub.3CN (895 mg, 14.24 mmol, 2.00 equiv) was added. The resulting solution was stirred for 30 min at 25.degree. C. The reaction mixture was concentrated under vacuum. The resulting solid was extracted with ethyl acetate (100 mL.times.5). The combined organic layers were concentrated and the residue purified by flash chromatography (DCE:MeOH=10:1). The product was further purified by Prep-HPLC with the following conditions: Column, X Bridge C18, 19*150 mm, 5 um; mobile phase, Mobile Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 20 mL/min; Detector, 254 nm. The fractions containing product were combined and concentrated, then acidified with hydrochloric acid (12N, 0.5 mL), and concentrated again under vacuum. This resulted in 200 mg of N-((1R,3R,5S)-8-((1s,4S)-4-aminocyclohexylsulfonyl)-8-aza-bicyclo[3- .2.1]octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide hydrochloride as a light yellow solid. .sup.1H-NMR (300 MHz, D.sub.2O): .delta. 6.25 (s, 1H), 4.15 (s, 2H), 4.10-4.00 (m, 1H), 3.42-3.25 (m, 2H), 2.25-1.75 (m, 17H), 1.09-1.00 (m, 2H), 0.92-0.81 (m, 2H) ppm. LCMS (method A, ESI): RT=1.69 min, m/z=445.2 [M+23]'.

Example 28

Synthesis of N-((1R,3r,5S)-8-(4-(2-aminopropan-2-yl)phenylsulfonyl)-8-aza-bicyclo[3.2.- 1]octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide (Cpd. No. 766)

##STR01230##

Step 1: Synthesis of N-((1R,3r,5S)-8-(4-bromophenylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-5- -cyclopropylisoxazole-3-carboxamide

##STR01231##

Into a 25-mL round-bottom flask was placed N-((1R,3r,5S)-8-aza-bicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-ca- rboxamide hydrochloride (500 mg, 1.68 mmol, 1.00 equiv), and dichloromethane (10 mL). This was followed by the dropwise addition of TEA (510 mg, 5.04 mmol, 3.00 equiv) with stirring at 0.degree. C. To this was added 4-bromobenzene-1-sulfonyl chloride (470 mg, 1.84 mmol, 1.10 equiv) in several batches at 0.degree. C. The resulting solution was stirred overnight at room temperature. The reaction mixture was diluted with 10 mL of dichloromethane. The resulting mixture was washed with 3.times.5 mL of H.sub.2O. The organic phase was collected and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:1). This resulted in 742 mg (92%) of N-((1R,3r,5S)-8-(4-bromophenylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-5- -cyclopropylisoxazole-3-carboxamide as a white solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 7.78-7.70 (m, 2H), 7.69-7.60 (m, 2H), 7.04 (br, 1H), 6.30 (s, 1H), 4.28 (brs, 3H), 2.39-2.25 (m, 2H), 2.11-2.00 (m, 1H), 1.97-1.72 (m, 6H), 1.18-1.07 (m, 2H), 1.00-0.92 (m, 2H) ppm. LCMS (Method D, ESI): RT=1.57 min, m/z=480.0 [M+H].sup.+.

Step 2: Synthesis of 5-cyclopropyl-N-((1R,3r,5S)-8-(4-(prop-1-en-2-yl)phenylsulfonyl)-8-aza-bi- cyclo[3.2.1]octan-3-yl)isoxazole-3-carboxamide

##STR01232##

Into a 50-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed N-((1R,3r,5S)-8-(4-bromophenylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-5- -cyclopropylisoxazole-3-carboxamide (642 mg, 1.34 mmol, 1.00 equiv), 4,4,5,5-tetramethyl-2-(prop-1-en-2-yl)-1,3,2-dioxaborolane (293 mg, 1.74 mmol, 1.30 equiv), Pd(dppf)Cl.sub.2 (98 mg, 0.13 mmol, 0.10 equiv), potassium carbonate (555 mg, 4.02 mmol, 3.00 equiv), 1,4-dioxane (15 mL) and water (1.5 mL). The resulting solution was stirred for 14 h at 90.degree. C. The reaction mixture was concentrated under vacuum. The resulting solution was diluted with 25 mL of H.sub.2O and extracted with 3.times.10 mL of ethyl acetate. The organic layers were combined and dried over anhydrous sodium sulfate. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:2). This resulted in 544 mg (92%) of 5-cyclopropyl-N-((1R,3r,5S)-8-(4-(prop-1-en-2-yl)phenylsulfonyl)-8-aza-bi- cyclo[3.2.1]octan-3-yl)isoxazole-3-carboxamide as a white solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 7.82 (d, J=8.7 Hz, 2H), 7.56 (d, J=8.7 Hz, 2H), 7.05 (br, 1H), 6.30 (s, 1H), 5.48 (s, 1H), 5.24 (s, 1H), 4.29 (brs, 3H), 2.41-2.26 (m, 2H), 2.17 (s, 3H), 2.11-2.00 (m, 1H), 1.97-1.70 (m, 6H), 1.16-1.05 (m, 2H), 1.01-0.92 (m, 2H) ppm. LCMS (Method D, ESI): RT=1.59 min, m/z=442.0 [M+H].sup.+.

Step 3: Synthesis of N-((1R,3r,5S)-8-(4-(2-(2-chloroacetamido)propan-2-yl)phenylsulfonyl)-8-az- a-bicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide

##STR01233##

Into a 100-mL round-bottom flask was placed 5-cyclopropyl-N-((1R,3r,5S)-8-(4-(prop-1-en-2-yl)phenylsulfonyl)-8-aza-bi- cyclo[3.2.1]octan-3-yl)isoxazole-3-carboxamide (544 mg, 1.23 mmol, 1.00 equiv), AcOH (39 mL), 2-chloroacetonitrile (1.85 g, 24.50 mmol, 19.89 equiv). This was followed by the dropwise addition of sulfuric acid (98%, 9.7 mL) with stirring at 0.degree. C. The resulting solution was stirred for 14 h at 25.degree. C. The reaction mixture was diluted with 100 mL of ice-water. The pH of the solution was adjusted to 7 with sodium carbonate (sat. aq.). The resulting solution was extracted with 3.times.50 ml, of ethyl acetate and the organic layers combined and dried over anhydrous sodium sulfate. After concentration, the residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:1). This resulted in 505 mg (77%) of N-((1R,3r,5S)-8-(4-(2-(2-chloro acetamido)propan-2-yl)phenylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-5-c- yclopropylisoxazole-3-carboxamide as a white solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 7.83 (d, J=8.7 Hz, 2H), 7.48 (d, J=8.4 Hz, 2H), 7.05 (br, 1H), 6.85 (brs, 1H), 6.30 (s, 1H), 4.27 (brs, 3H), 3.98 (s, 2H), 2.40-2.26 (m, 2H), 2.11-2.00 (m, 1H), 1.95-1.76 (m, 6H), 1.75 (s, 6H), 1.15-1.05 (m, 2H), 1.00-0.91 (m, 2H) ppm. LCMS (Method D, ESI): RT=1.07 min, m/z=535.0 [M+H].sup.+.

Step 4: Synthesis of N-((1R,3r,5S)-8-(4-(2-aminopropan-2-yl)phenylsulfonyl)-8-aza-bicyclo[3.2.- 1]octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide

##STR01234##

Into a 25-mL round-bottom flask was placed N-((1R,3r,5S)-8-(4-(2-(2-chloroacetamido)propan-2-yl)phenylsulfonyl)-8-az- a-bicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide (593 mg, 1.11 mmol, 1.00 equiv), ethanol (6.0 mL), and thiourea (101 mg, 1.33 mmol, 1.20 equiv). This was followed by the dropwise addition of AcOH (1.2 mL) with stirring. The resulting solution was stirred for 12 h at 85.degree. C. The reaction mixture was concentrated under vacuum. The residue was dissolved in 10 mL of ethyl acetate and washed with 2.times.5 mL of H.sub.2O. Concentration yielded 465 mg (91%) of N-((1S,3r,5R)-8-(4-(2-aminopropan-2-yl)phenylsulfonyl)-8-aza-bicyclo[3.2.- 1]octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide as an off-white solid. The crude product (100 mg) was purified by Prep-HPLC with the following conditions: Column: X Bridge C18, 19*150 mm, 5 um; Mobile Phase A: Water/10 mmol/L NH.sub.4HCO.sub.3, Mobile Phase B: MeOH; Flow rate: 30 mL/min; Gradient: 45% B to 75% B in 06 min; 254 nm. 120 mL of fractions contained product was obtained resulting in 18.4 mg of N-((1R,3r,5S)-8-(4-(2-aminopropan-2-yl)phenylsulfonyl)-8-aza-bicyclo[3.2.- 1]octan-3-yl)-5-cyclopropylisoxazole-3-carboxamide as a white solid. .sup.1H-NMR (400 MHz, CD.sub.3OD): .delta. 7.87 (d, J=8.8 Hz, 2H), 7.73 (d, J=8.4 Hz, 2H), 6.35 (s, 1H), 4.27 (brs, 2H), 4.20-4.10 (m, 1H), 2.32-2.21 (m, 2H), 2.20-2.10 (m, 1H), 2.00 (d, J=14.4 Hz, 2H), 1.93-1.82 (m, 2H), 1.63-1.55 (m, 2H), 1.54 (s, 6H), 1.18-1.10 (m, 2H), 1.00-0.91 (m, 2H) ppm. LCMS (Method A, ESI): RT=1.77 min, m/z=481.0 [M+Na].sup.+.

Example 29

Synthesis of 5-cyclopropyl-N-((1S,3r,5R)-8-((l-methylpiperidin-4-yl)methylsulfonyl)-8-- aza-bicyclo[3.2.1]octan-3-yl)isoxazole-3-carboxamide (Cpd. No. 770)

##STR01235##

Step 1: Synthesis of benzyl 4-((methylsulfonyloxy)methyl)piperidine-1-carboxylate

##STR01236##

Into a 1000-mL round-bottom flask, was placed benzyl 4-(hydroxymethyl)piperidine-1-carboxylate (100 g, 401.11 mmol, 1.00 equiv), dichloromethane (300 mL), triethylamine (121 g, 1.20 mol, 3.00 equiv). This was followed by the addition of methanesulfonyl chloride (91.6 g, 799.64 mmol, 2.00 equiv) dropwise with stirring at 0.degree. C. The resulting solution was stirred for 16 h at 25.degree. C. The resulting mixture was washed with 2.times.500 mL of H.sub.2O. The resulting mixture was concentrated under vacuum. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (1:2). This resulted in 116 g (88%) of benzyl 4-((methylsulfonyloxy)methyl)piperidine-1-carboxylate as a yellow solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 7.40-7.29 (m, 5H), 5.07 (s, 2H), 4.08-4.01 (m, 4H), 3.17 (s, 3H), 2.90-2.70 (m, 2H), 1.99-1.86 (m, 1H), 1.69-1.66 (m, 2H), 1.20-1.15 (m, 2H) ppm. LCMS (method D, ESI): RT=1.46 min, m/z=328.0 [M+H].sup.+.

Step 2: Synthesis of benzyl 4-(acetylthiomethyl)piperidine-1-carboxylate

##STR01237##

Into a 2000-mL round-bottom flask, was placed benzyl 4-[(methanesulfonyloxy)methyl]piperidine-1-carboxylate (116 g, 354.31 mmol, 1.00 equiv), acetonitrile (1000 mL), 1-(potassiosulfanyl)ethan-1-one (190 g, 1.66 mol, 5.00 equiv). The resulting solution was stirred for 2 h at 80.degree. C. in an oil bath. The resulting solution was extracted with 2.times.500 mL of ethyl acetate and the organic layers combined and dried over anhydrous sodium sulfate and concentrated under vacuum. This resulted in 105 g (96%) of benzyl 4-(acetylthiomethyl)piperidine-1-carboxylate as red oil. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 7.40-7.29 (m, 5H), 5.12 (s, 2H), 4.20-4.13 (m, 2H), 2.83-2.70 (m, 4H), 2.34 (s, 3H), 1.78-1.70 (m, 2H), 1.68-1.57 (m, 1H), 1.28-1.22 (m, 2H) ppm. LCMS (method A, ESI): RT=1.53 min, m/z=308.0 [M+H].sup.+

Step 3: Synthesis of benzyl 4-(chlorosulfonylmethyl)piperidine-1-carboxylate

##STR01238##

Into a 1000-mL round-bottom flask, was placed benzyl 4-[(acetylsulfanyl)methyl]piperidine-1-carboxylate (105 g, 341.57 mmol, 1.00 equiv), acetic acid (500 mL), water (250 mL). This was followed by the addition of N-chlorosuccinimide (160 g, 1.20 mol, 3.50 equiv) in several batches at 0.degree. C. The resulting solution was stirred for 2 h at 25.degree. C. The resulting solution was extracted with 2.times.500 mL of dichloromethane and the organic layers combined and concentrated under vacuum. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (1:4). This resulted in 95 g (84%) of benzyl 4-(chlorosulfonylmethyl)piperidine-1-carboxylate as a light yellow solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 7.41-7.28 (m, 5H), 5.12 (s, 2H), 4.24-4.08 (m, 2H), 3.65 (d, J=6.3 Hz, 2H), 2.89-2.73 (m, 3H), 2.43-2.31 (m, 1H), 2.07-1.95 (m, 2H), 1.43-1.21 (m, 2H) ppm. LCMS (method A, ESI): RT=1.48 min, m/z=332.0 [M+H].sup.+.

Step 4: Synthesis of benzyl 4-(((1S,3r,5R)-3-(5-cyclopropylisoxazole-3-carboxamido)-8-aza-bicyclo[3.2- .1]octan-8-ylsulfonyl)methyl)piperidine-1-carboxylate

##STR01239##

Into a 1000-mL round-bottom flask, was placed N-((1S,3r,5R)-8-aza-bicyclo[3.2.1]octan-3-yl)-5-cyclopropylisoxazole-3-ca- rboxamide hydrochloride (28.4 g, 95.37 mmol, 1.00 equiv), dichloromethane (500 mL), triethylamine (100 g, 988.24 mmol, 10.00 equiv). This was followed by the addition of benzyl 4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (35 g, 105.48 mmol, 1.10 equiv) in several batches at -70.degree. C. The resulting solution was stirred for 16 h at 25.degree. C. The resulting mixture was washed with 2.times.300 mL of H.sub.2O. The organic phase was collected. The resulting mixture was concentrated under vacuum. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (1:1). This resulted in 34 g (64%) of benzyl 4-(((1S,3r,5R)-3-(5-cyclopropylisoxazole-3-carboxamido)-8-aza-bicyclo[3.2- .1]octan-8-ylsulfonyl)methyl)piperidine-1-carboxylate as a white solid. .sup.1H-NMR (300 MHz, CDCl.sub.3): .delta. 7.36-7.26 (m, 5H), 7.10 (d, J=7.2 Hz, 1H), 6.32 (s, 1H), 5.12 (s, 2H), 4.31-4.16 (m, 5H), 2.92-2.84 (m, 4H), 2.31-1.92 (m, 12H), 1.31-1.24 (m, 2H), 1.14-1.09 (m, 2H), 1.01-0.97 (m, 2H) ppm. LCMS (method B, ESI): RT=1.59 min, m/z=557.0[M+H].sup.+.

Step 5: Synthesis of 5-cyclopropyl-N-((1S,3r,5R)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicycl- o[3.2.1]octan-3-yl)isoxazole-3-carboxamide hydrochloride

##STR01240##

Into a 1000-mL round-bottom flask, was placed benzyl 4-(((1S,3r,5R)-3-(5-cyclopropylisoxazole-3-carboxamido)-8-aza-bicyclo[3.2- .1]octan-8-ylsulfonyl)methyl)piperidine-1-carboxylate (48 g, 86.23 mmol, 1.00 equiv), hydrochloric acid (12 N, 500 mL). The resulting solution was stirred for 8 h at 25.degree. C. The resulting mixture was concentrated under vacuum. This resulted in 39 g (99%) of 5-cyclopropyl-N-((1S,3r,5R)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicycl- o[3.2.1]octan-3-yl)isoxazole-3-carboxamide hydrochloride as an off-white solid. LCMS (method A, ESI): RT=0.99 min, m/z=423.0[M+H].sup.+

Step 6: Synthesis of 5-cyclopropyl-N-((1S,3r,5R)-8-((l-methylpiperidin-4-yl)methylsulfonyl)-8-- aza-bicyclo[3.2.1]octan-3-yl)isoxazole-3-carboxamide

##STR01241##

In Into a 2000-mL round-bottom flask, was placed 5-cyclopropyl-N-((1S,3r,5R)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicycl- o[3.2.1]octan-3-yl)isoxazole-3-carboxamide hydrochloride (42 g, 91.50 mmol, 1.00 equiv), methanol (800 mL), formaldehyde (40 mL), acetic acid (8 mL). The resulting solution was stirred for 0.5 h at 25.degree. C. This was followed by the addition of sodium cyanoborohydride (11 g, 175.05 mmol, 2.00 equiv) in several batches at 0.degree. C. The resulting solution was stirred for 2 h at 25.degree. C. The resulting mixture was concentrated under vacuum. The pH value of the solution was adjusted to 10 with sodium hydroxide (1 N). The resulting solution was extracted with 2.times.500 mL of dichloromethane and the organic layers combined and dried over anhydrous sodium sulfate. The resulting mixture was concentrated under vacuum. This resulted in 38.9 g (98%) of 5-cyclopropyl-N-((1S,3r,5R)-8-((1-methylpiperidin-4-yl)methylsulfonyl)-8-- aza-bicyclo[3.2.1]octan-3-yl)isoxazole-3-carboxamide as an off-white solid. .sup.1H-NMR (300 MHz, CD.sub.3OD): .delta. 6.41 (s, 1H), 4.28-4.18 (m, 3H), 3.10 (d, J=6.0 Hz, 2H), 2.94 (d, J=12.0 Hz, 2H), 2.34-1.95 (m, 17H), 1.60-1.40 (m, 2H), 1.21-1.15 (m, 2H), 1.05-0.98 (m, 2H) ppm. LCMS (method B, ESI): RT=1.64 min, m/z=437.1 [M+H].sup.+.

Example 30

SMYD3 Biochemical Assay

General Materials

S-adenosylmethionine (SAM), S-adenosylhomocysteine (SAH), Tris, Tween20, dimethylsulfoxide (DMSO), bovine skin gelatin (BSG), and Tris(2-carboxyethyl)phosphine hydrochloride solution (TCEP) were purchased from Sigma-Aldrich at the highest level of purity possible. .sup.3H-SAM was purchase from American Radiolabeled Chemicals with a specific activity of 80 Ci/mmol. 384-well opaque white OptiPlates and SPA beads (Perkin Elmer, catalog # RPNQ0013) were purchased from PerkinElmer.

Substrates

N-terminally GST-tagged MEKK2 (MAP3K2) protein corresponding to reference sequence AAF63496.3 was purchased from Life Technologies (catalog # PV4010). This protein was expressed in High Five insect cells and purified to >85% purity. Protein identity was confirmed by MS/MS analysis after proteolytic digestion. The protein sequence used was:

TABLE-US-00012 (SEQ ID No. 1). MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELG LEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGA VLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDH VTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSS KYIAWPLQGWQATFGGGDHPPKSDLVPRHNQTSLYKKAGTMDDQQALNS IMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQ FPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKALELLD RSIHMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIG PTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMEQMLDPLS LSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSYPDNHQEFSDYDNPI FEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGNQLTSPVSFSP TDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRA PTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVN ALECEIQLLKNLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLK AYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKL GDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGQGYGRKADIWSVA CTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRI FVEAKLRPSADELLRHMFVHYH.

Molecular Biology

Full-length human SMYD3 isoform 1 (BAB86333) was inserted into a modified pET21b plasmid containing a His6 tag and TEV and SUMO cleavage sites. Because two common variants of SMYD3 exist in the population, site directed mutagenesis was subsequently performed to change amino acid 13 from an asparagine to a lysine, resulting in plasmid pEPZ533. A lysine at position 13 conforms to the more commonly occurring sequence (NP 001161212).

Protein Expression

E. coli (BL21 codonplus RIL strain, Stratagene) were transformed with plasmid pEPZ553 by mixing competent cells and plasmid DNA and incubating on ice for 30 minutes followed by heat shock at 42.degree. C. for 1 minute and cooling on ice for 2 minutes. Transformed cells were grown and selected on LB agar with 100 .mu.g/mL ampicillin and 17 .mu.g/mL chloramphenicol at 37.degree. C. overnight. A single clone was used to inoculate 200 mL of LB medium with 100 .mu.g/mL ampicillin and 17 .mu.g/mL chloramphenicol and incubated at 37.degree. C. on an orbital shaker at 180 rpm. Once in log growth, the culture was diluted 1:100 into 2 L of LB medium and grown until OD.sub.600 was about 0.3 after which the culture was incubated at 15.degree. C. and 160 rpm. Once OD.sub.600 reached about 0.4, IPTG was added to a final concentration of 0.1 mM and the cells were grown overnight at 15.degree. C. and 160 rpm. Cells were harvested by centrifugation at 8000 rpm, for 4 minutes at 4.degree. C. and stored at -80.degree. C. for purification.

Protein Purification

Expressed full-length human His-tagged SMYD3 protein was purified from cell paste by Nickel affinity chromatography after equilibration of the resin with Buffer A (25 mM Tris, 200 mM NaCl, 5% glycerol, 5 mM .beta.-mercaptoethanol, pH7.8). The column was washed with Buffer B (Buffer A plus 20 mM imidazole) and His-tagged SMYD3 was eluted with Buffer C (Buffer A plus 300 mM imidazole). The His tag, TEV and SUMO cleavage sites were removed generating native SMYD3 by addition of ULP1 protein at a ratio of 1:200 (ULP1:SMYD3). Imidazole was removed by dialysis overnight in Buffer A. The dialyzed solution was applied to a second Nickel column and the native SMYD3 protein was collected from the column flow-through. The flow-through was dialyzed in Buffer D (25 mM Tris, 5% glycerol, 5 mM .beta.-mercaptoethanol, 50 mM NaCl, pH7.8) and ULP1 was removed using a Q sepharose fast flow column. SMYD3 was eluted in Buffer A and further purified using an S200 size-exclusion column equilibrated with Buffer A. SMYD3 was concentrated to 2 mg/mL with a final purity of 89%.

Predicted Translation:

TABLE-US-00013 SMYD3 (Q9H7B4) (SEQ ID No. 2). MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVC DRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYP PDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQL VMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVG LYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMT SEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIE ELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGL LEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKN LRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS.

General Procedure for SMYD3 Enzyme Assays on MEKK2 Protein Substrate

The assays were all performed in a buffer consisting of 25 mM Tris-Cl pH 8.0, 1 mM TCEP, 0.005% BSG, and 0.005% Tween 20, prepared on the day of use. Compounds in 100% DMSO (1 ul) were spotted into a 384-well white opaque OptiPlate using a Bravo automated liquid handling platform outfitted with a 384-channel head (Agilent Technologies). DMSO (1 ul) was added to Columns 11, 12, 23, 24, rows A-H for the maximum signal control and 1 ul of SAH, a known product and inhibitor of SMYD3, was added to columns 11, 12, 23, 24, rows I-P for the minimum signal control. A cocktail (40 ul) containing the SMYD3 enzyme was added by Multidrop Combi (Thermo-Fisher). The compounds were allowed to incubate with SMYD3 for 30 min at room temperature, then a cocktail (10 ul) containing SAM and MEKK2 was added to initiate the reaction (final volume=51 ul). The final concentrations of the components were as follows: SMYD3 was 0.4 nM, .sup.3H-SAM was 8 nM, MEKK2 was 12 nM, SAH in the minimum signal control wells was 1 mM, and the DMSO concentration was 2%. The assays were stopped by the addition of non-radiolabeled SAM (10 ul) to a final concentration of 100 uM, which dilutes the .sup.3H-SAM to a level where its incorporation into MEKK2 is no longer detectable. Radiolabeled MEKK2 was detected using a scintillation proximity assay (SPA). 10 uL of a 10 mg/mL solution of SPA beads in 0.5 M citric acid was added and the plates centrifuged at 600 rpm for 1 min to precipitate the radiolabeled MEKK2 onto the SPA beads. The plates were then read in a PerkinElmer TopCount plate reader to measure the quantity of .sup.3H-labeled MEKK2 as disintegrations per minute (dpm) or alternatively, referred to as counts per minute (cpm).

% Inhibition Calculation

.times..times..times. ##EQU00001##

Where dpm=disintegrations per minute, cmpd=signal in assay well, and min and max are the respective minimum and maximum signal controls.

Four-Parameter IC50 Fit

.times..times. ##EQU00002##

Where top and bottom are the normally allowed to float, but may be fixed at 100 or 0 respectively in a 3-parameter fit. The Hill Coefficient normally allowed to float but may also be fixed at 1 in a 3-parameter fit. Y is the % inhibition and X is the compound concentration.

SMYD3 biochemical assay data for representative Compounds of the Disclosure are presented in Tables 1A, 2A, and 3A in the column titled "SMYD3 Biochem IC.sub.50 (.mu.M)."

Example 31

SMYD3 Cell Assay

Trimethyl-MEKK2-in-Cell Western Assay

293T/17 adherent cells were purchased from ATCC (American Type Culture Collection), Manassas, Va., USA. MEM/Glutamax medium, Optimem Reduced Serum medium, penicillin-streptomycin, 0.05% trypsin and 1.times.D-PBS were purchased from Life Technologies, Grand Island, N.Y., USA. PBS-10.times. was purchased from Ambion, Life Technologies, Grand Island, N.Y., USA. PBS with Tween 20 (PBST (10.times.)) was purchased from KPL, Gaithersburg, Md., USA. Tet System FBS-approved FBS US Source was purchased from Clontech, Mountain View, Calif., USA. Odyssey blocking buffer, 800CW goat anti-rabbit IgG (H+L) antibody, 680CW Goat anti-mouse IgG (H+L) and Licor Odyssey infrared scanner were purchased from Licor Biosciences, Lincoln, Nebr., USA. Tri-methyl-Lysine [A260]-MEKK2 antibody, MEKK2 and SMYD3 plasmids were made at Epizyme. Anti-flag monoclonal mouse antibody was purchased from Sigma, St. Louis, Mo., USA. Methanol was purchased from VWR, Franklin, Mass., USA. 10% Tween 20 was purchased from KPL, Inc., Gaithersburg, Md., USA. Fugene was purchased from Promega, Madison, Wis., USA. The Biotek ELx405 was purchased from BioTek, Winooski, Vt., USA. The multidrop combi was purchased from Thermo Scientific, Waltham, Mass., USA.

293T/17 adherent cells were maintained in growth medium (MEM/Glutamax medium supplemented with 10% v/v Tet System FBS and cultured at 37.degree. C. under 5% CO.sub.2.

Cell Treatment, in Cell Western (ICW) for Detection of Trimethyl-Lysine-MEKK2 and MEKK2.

293T/17 cells were seeded in assay medium at a concentration of 33,333 cells per cm.sup.2 in 30 mL medium per T150 flask and incubated at 37.degree. C. under 5% CO.sub.2. Plasmids were prepared for delivery to cells by first mixing 1350 .mu.L Opti-MEM with Fugene (81 .mu.L) in a sterile Eppendorf and incubated for five minutes at room temperature (RT). MEKK2-flag (13.6 ug/T150) MEKK2 p3XFlag-CMV-14 with C-3XFlag and SMYD3 (0.151 ug/T150) SMYD3 p3XFlag-CMV-14 without C-3XFlag plasmids were aliquotted to a 1.7 mL sterile microfuge tube. The gene ID for MEKK2 and SMYD3 is NM 006609.3 and Q9H7B4, respectively. Entire volume of Opti-MEM/Fugene mixture was then added to a microfuge tube containing DNA plasmid, mixed and then incubated.times.15 minutes at RT. The medium on the 293T/17 cells was refreshed, and the DNA/Fugene complex is added aseptically to each flask, rocked gently, and incubated at 37 C for 5 hours. Medium was then removed, and cells were washed once with PBS in the flask. Trypsin 0.05% (3 mL) was added and cells incubated for three minutes. Room temperature MEM+10% Tet system FBS was added and cells were mixed gently, and counted using the Vi-cell. Cells were seeded at 100,000 cells/mL in 50 .mu.L MEM/10% Tet FBS/Pen/Strep to a 384 well black/clear poly-D-lysine coated plate containing test agent diluted in DMSO. The final top concentration of test compound was 40 .mu.M. The total concentration of DMSO did not exceed 0.2% (v/v). Plates were incubated.times.30 minutes at RT in low-airflow area, followed by incubation at 37.degree. C. under 5% CO.sub.2 for 24 hours. Medium was aspirated from all wells of assay plates prior to fixation and permeabilization with ice cold (-20.degree. C.) methanol (90 .mu.L/well) for ten minutes. Plates were rinsed with PBS three times on BioTek ELx405. PBS was removed with a final aspiration, and Odyssey blocking buffer (50 .mu.L/well) was added to each well and incubated for one hour at RT. Primary antibody solution was prepared (anti-trimethyl-MEKK2 at 1:600 dilution plus mouse anti-flag antibody at 1:10,000 dilution in diluent (Odyssey Blocking buffer+0.1% Tween 20)) and 20 .mu.L per well was dispensed using the Multidrop Combi. Assay plates were then sealed with foil, and incubated overnight at 4.degree. C. Plates were washed five times with PBS-Tween (1.times.) on Biotek ELx405 and blotted on paper towel to remove excess reagent. Detection antibody solution (IRDye 800 CW goat anti-rabbit IgG diluted 1:400 in diluent (Odyssey Blocking buffer+0.1% Tween 20), plus IRDye 680CW goat anti-mouse IgG at 1:500 in diluent (Odyssey Blocking buffer+0.1% Tween 20) was added (20 .mu.L/well) and incubated in dark for one hour at RT. Plates were then washed four times with PBS-T (1.times.) on ELx405. A final rinse with water was performed (115 .mu.L/well.times.three washes on the ELx405). Plates were then centrifuged upside down, on paper towel, at 200.times.g to remove excess reagent. Plates were left to dry in dark for one hour. The Odyssey Imager was used to measure the integrated intensity of 700 and 800 wavelengths at resolution of 84 .mu.m, medium quality, focus offset 4.0, 700 channel intensity=3.5 to measure the MEKK2-flag signal, 800 channel intensity=5 to measure the Trimethyl-MEKK2 signal of each well.

Calculations:

First, the ratio for each well was determined by:

.times..times..times..times..times..times..times..times..times..times..ti- mes..times..times..times..times..times..times..times..times..times..times.- .times. ##EQU00003##

Each plate included fourteen control wells of DMSO only treatment (Minimum Inhibition) as well as fourteen control wells for maximum inhibition (Background). The average of the ratio values for each control type was calculated and used to determine the percent inhibition for each test well in the plate. Reference compound was serially diluted two-fold in DMSO for a total of nine test concentrations, beginning at 40 .mu.M.

Percent inhibition was calculated (below).

.times..times..times..times..times..times..times..times..times..times..ti- mes..times..times..times..times..times..times..times..times..times. ##EQU00004##

Non-linear regression curves were generated to calculate the IC.sub.50 and dose-response relationship using triplicate wells per concentration of compound.

SMYD3 cell assay data for representative Compounds of the Disclosure are presented in Tables 1A, 2A, and 3A in the column titled "SMYD3 Cell IC.sub.50 (.mu.M)."

Example 32

SMYD2 Assay

General Materials

S-adenosylmethionine (SAM), S-adenosylhomocysteine (SAH), bicine, Tween20, dimethylsulfoxide (DMSO), bovine skin gelatin (BSG), and Tris(2-carboxyethyl)phosphine hydrochloride (TCEP) were purchased from Sigma-Aldrich at the highest level of purity possible. .sup.3H-SAM was purchase from American Radiolabeled Chemicals with a specific activity of 80 Ci/mmol. 384-well streptavidin Flashplates were purchased from PerkinElmer.

Substrates

Peptide was synthesized with a N-terminal linker-affinity tag motif and a C-terminal amide cap by 21.sup.st Century Biochemicals. The peptide was high high-performance liquid chromatography (HPLC) purified to greater than 95% purity and confirmed by liquid chromatography mass spectrometry (LC-MS). The sequence was ARTKQTARKSTGGKAPRKQLATKAARKSA(K-Biot)-amide. (SEQ ID NO:3) Production of Recombinant SMYD2 Enzymes for Biochemical Enzyme Activity Assays

Full length SMYD2 (NP 064582.2) was cloned into a pFastbac-Htb-lic vector with an N-terminal His6 tag and FLAG tag, preceded by a TEV protease cleavage site. The protein was expressed in Sf9 insect cells. Cells were resuspended in lysis buffer (25 mM HEPES-NaOH, pH 7.5, 200 mM NaCl, 5% glycerol, and 5 mM (3-ME) and lysed by sonication. The protein was purified by Ni-NTA (Qiagen), followed by TEV cleavage to remove the His6 tag, subtractive Ni-NTA (Qiagen), and gel filtration chromatography using an S200 column (GE Healthcare). Purified protein was stored in 20 mM Tris-HCl, pH 8.0, 100 mM NaCl, and 1 mM TCEP.

General Procedure for SMYD2 Enzyme Assays on Peptide Substrates

The assays were all performed in a buffer consisting of 20 mM Bicine (pH=7.6), 1 mM TCEP, 0.005% Bovine Skin Gelatin, and 0.002% Tween20, prepared on the day of use. Compounds in 100% DMSO (1 ul) were spotted into a polypropylene 384-well V-bottom plates (Greiner) using a Platemate Plus outfitted with a 384-channel head (Thermo Scientific). DMSO (1 ul) was added to Columns 11, 12, 23, 24, rows A-H for the maximum signal control and 1 ul of SAH, a known product and inhibitor of SMYD2, was added to columns 11, 12, 23, 24, rows I-P for the minimum signal control. A cocktail (40 ul) containing the SMYD2 enzyme was added by Multidrop Combi (Thermo-Fisher). The compounds were allowed to incubate with SMYD2 for 30 min at room temperature, then a cocktail (10 ul) containing .sup.3H-SAM and peptide was added to initiate the reaction (final volume=51 ul). The final concentrations of the components were as follows: SMYD2 was 1.5 nM, .sup.3H-SAM was 10 nM, and peptide was 60 nM, SAH in the minimum signal control wells was 1000 uM, and the DMSO concentration was 2%. The assays were stopped by the addition of non-radioactive SAM (10 ul) to a final concentration of 600 uM, which dilutes the .sup.3H-SAM to a level where its incorporation into the peptide substrate is no longer detectable. 50 ul of the reaction in the 384-well polypropylene plate was then transferred to a 384-well Flashplate and the biotinylated peptides were allowed to bind to the streptavidin surface for at least 1 hour before being washed three times with 0.1% Tween20 in a Biotek ELx405 plate washer. The plates were then read in a PerkinElmer TopCount plate reader to measure the quantity of .sup.3H-labeled peptide bound to the Flashplate surface, measured as disintegrations per minute (dpm) or alternatively, referred to as counts per minute (cpm).

% Inhibition Calculation

.times..times..times. ##EQU00005##

Where dpm=disintegrations per minute, cmpd=signal in assay well, and min and max are the respective minimum and maximum signal controls.

Four-Parameter IC50 Fit

.times..times..times..function..times..times. ##EQU00006##

Where top and bottom are the normally allowed to float, but may be fixed at 100 or 0 respectively in a 3-parameter fit. The Hill Coefficient normally allowed to float but may also be fixed at 1 in a 3-parameter fit. I is the compound concentration.

Having now fully described this invention, it will be understood by those of ordinary skill in the art that the same can be performed within a wide and equivalent range of conditions, formulations, and other parameters without affecting the scope of the invention or any embodiment thereof.

Other embodiments of the invention will be apparent to those skilled in the art from consideration of the specification and practice of the invention disclosed herein. It is intended that the specification and examples be considered as exemplary only, with a true scope and spirit of the invention being indicated by the following claims.

All patents and publications cited herein are fully incorporated by reference herein in their entirety.

SEQUENCE LISTINGS

1

31855PRTArtificial Sequencesynthesized protein 1Met Ala Pro Ile Leu Gly Tyr Trp Lys Ile Lys Gly Leu Val Gln Pro1 5 10 15Thr Arg Leu Leu Leu Glu Tyr Leu Glu Glu Lys Tyr Glu Glu His Leu 20 25 30Tyr Glu Arg Asp Glu Gly Asp Lys Trp Arg Asn Lys Lys Phe Glu Leu 35 40 45Gly Leu Glu Phe Pro Asn Leu Pro Tyr Tyr Ile Asp Gly Asp Val Lys 50 55 60Leu Thr Gln Ser Met Ala Ile Ile Arg Tyr Ile Ala Asp Lys His Asn65 70 75 80Met Leu Gly Gly Cys Pro Lys Glu Arg Ala Glu Ile Ser Met Leu Glu 85 90 95Gly Ala Val Leu Asp Ile Arg Tyr Gly Val Ser Arg Ile Ala Tyr Ser 100 105 110Lys Asp Phe Glu Thr Leu Lys Val Asp Phe Leu Ser Lys Leu Pro Glu 115 120 125Met Leu Lys Met Phe Glu Asp Arg Leu Cys His Lys Thr Tyr Leu Asn 130 135 140Gly Asp His Val Thr His Pro Asp Phe Met Leu Tyr Asp Ala Leu Asp145 150 155 160Val Val Leu Tyr Met Asp Pro Met Cys Leu Asp Ala Phe Pro Lys Leu 165 170 175Val Cys Phe Lys Lys Arg Ile Glu Ala Ile Pro Gln Ile Asp Lys Tyr 180 185 190Leu Lys Ser Ser Lys Tyr Ile Ala Trp Pro Leu Gln Gly Trp Gln Ala 195 200 205Thr Phe Gly Gly Gly Asp His Pro Pro Lys Ser Asp Leu Val Pro Arg 210 215 220His Asn Gln Thr Ser Leu Tyr Lys Lys Ala Gly Thr Met Asp Asp Gln225 230 235 240Gln Ala Leu Asn Ser Ile Met Gln Asp Leu Ala Val Leu His Lys Ala 245 250 255Ser Arg Pro Ala Leu Ser Leu Gln Glu Thr Arg Lys Ala Lys Ser Ser 260 265 270Ser Pro Lys Lys Gln Asn Asp Val Arg Val Lys Phe Glu His Arg Gly 275 280 285Glu Lys Arg Ile Leu Gln Phe Pro Arg Pro Val Lys Leu Glu Asp Leu 290 295 300Arg Ser Lys Ala Lys Ile Ala Phe Gly Gln Ser Met Asp Leu His Tyr305 310 315 320Thr Asn Asn Glu Leu Val Ile Pro Leu Thr Thr Gln Asp Asp Leu Asp 325 330 335Lys Ala Leu Glu Leu Leu Asp Arg Ser Ile His Met Lys Ser Leu Lys 340 345 350Ile Leu Leu Val Ile Asn Gly Ser Thr Gln Ala Thr Asn Leu Glu Pro 355 360 365Leu Pro Ser Leu Glu Asp Leu Asp Asn Thr Val Phe Gly Ala Glu Arg 370 375 380Lys Lys Arg Leu Ser Ile Ile Gly Pro Thr Ser Arg Asp Arg Ser Ser385 390 395 400Pro Pro Pro Gly Tyr Ile Pro Asp Glu Leu His Gln Val Ala Arg Asn 405 410 415Gly Ser Phe Thr Ser Ile Asn Ser Glu Gly Glu Phe Ile Pro Glu Ser 420 425 430Met Glu Gln Met Leu Asp Pro Leu Ser Leu Ser Ser Pro Glu Asn Ser 435 440 445Gly Ser Gly Ser Cys Pro Ser Leu Asp Ser Pro Leu Asp Gly Glu Ser 450 455 460Tyr Pro Lys Ser Arg Met Pro Arg Ala Gln Ser Tyr Pro Asp Asn His465 470 475 480Gln Glu Phe Ser Asp Tyr Asp Asn Pro Ile Phe Glu Lys Phe Gly Lys 485 490 495Gly Gly Thr Tyr Pro Arg Arg Tyr His Val Ser Tyr His His Gln Glu 500 505 510Tyr Asn Asp Gly Arg Lys Thr Phe Pro Arg Ala Arg Arg Thr Gln Gly 515 520 525Asn Gln Leu Thr Ser Pro Val Ser Phe Ser Pro Thr Asp His Ser Leu 530 535 540Ser Thr Ser Ser Gly Ser Ser Ile Phe Thr Pro Glu Tyr Asp Asp Ser545 550 555 560Arg Ile Arg Arg Arg Gly Ser Asp Ile Asp Asn Pro Thr Leu Thr Val 565 570 575Met Asp Ile Ser Pro Pro Ser Arg Ser Pro Arg Ala Pro Thr Asn Trp 580 585 590Arg Leu Gly Lys Leu Leu Gly Gln Gly Ala Phe Gly Arg Val Tyr Leu 595 600 605Cys Tyr Asp Val Asp Thr Gly Arg Glu Leu Ala Val Lys Gln Val Gln 610 615 620Phe Asp Pro Asp Ser Pro Glu Thr Ser Lys Glu Val Asn Ala Leu Glu625 630 635 640Cys Glu Ile Gln Leu Leu Lys Asn Leu Leu His Glu Arg Ile Val Gln 645 650 655Tyr Tyr Gly Cys Leu Arg Asp Pro Gln Glu Lys Thr Leu Ser Ile Phe 660 665 670Met Glu Tyr Met Pro Gly Gly Ser Ile Lys Asp Gln Leu Lys Ala Tyr 675 680 685Gly Ala Leu Thr Glu Asn Val Thr Arg Lys Tyr Thr Arg Gln Ile Leu 690 695 700Glu Gly Val His Tyr Leu His Ser Asn Met Ile Val His Arg Asp Ile705 710 715 720Lys Gly Ala Asn Ile Leu Arg Asp Ser Thr Gly Asn Val Lys Leu Gly 725 730 735Asp Phe Gly Ala Ser Lys Arg Leu Gln Thr Ile Cys Leu Ser Gly Thr 740 745 750Gly Met Lys Ser Val Thr Gly Thr Pro Tyr Trp Met Ser Pro Glu Val 755 760 765Ile Ser Gly Gln Gly Tyr Gly Arg Lys Ala Asp Ile Trp Ser Val Ala 770 775 780Cys Thr Val Val Glu Met Leu Thr Glu Lys Pro Pro Trp Ala Glu Phe785 790 795 800Glu Ala Met Ala Ala Ile Phe Lys Ile Ala Thr Gln Pro Thr Asn Pro 805 810 815Lys Leu Pro Pro His Val Ser Asp Tyr Thr Arg Asp Phe Leu Lys Arg 820 825 830Ile Phe Val Glu Ala Lys Leu Arg Pro Ser Ala Asp Glu Leu Leu Arg 835 840 845His Met Phe Val His Tyr His 850 8552428PRTArtificial Sequencesynthesized protein 2Met Glu Pro Leu Lys Val Glu Lys Phe Ala Thr Ala Lys Arg Gly Asn1 5 10 15Gly Leu Arg Ala Val Thr Pro Leu Arg Pro Gly Glu Leu Leu Phe Arg 20 25 30Ser Asp Pro Leu Ala Tyr Thr Val Cys Lys Gly Ser Arg Gly Val Val 35 40 45Cys Asp Arg Cys Leu Leu Gly Lys Glu Lys Leu Met Arg Cys Ser Gln 50 55 60Cys Arg Val Ala Lys Tyr Cys Ser Ala Lys Cys Gln Lys Lys Ala Trp65 70 75 80Pro Asp His Lys Arg Glu Cys Lys Cys Leu Lys Ser Cys Lys Pro Arg 85 90 95Tyr Pro Pro Asp Ser Val Arg Leu Leu Gly Arg Val Val Phe Lys Leu 100 105 110Met Asp Gly Ala Pro Ser Glu Ser Glu Lys Leu Tyr Ser Phe Tyr Asp 115 120 125Leu Glu Ser Asn Ile Asn Lys Leu Thr Glu Asp Lys Lys Glu Gly Leu 130 135 140Arg Gln Leu Val Met Thr Phe Gln His Phe Met Arg Glu Glu Ile Gln145 150 155 160Asp Ala Ser Gln Leu Pro Pro Ala Phe Asp Leu Phe Glu Ala Phe Ala 165 170 175Lys Val Ile Cys Asn Ser Phe Thr Ile Cys Asn Ala Glu Met Gln Glu 180 185 190Val Gly Val Gly Leu Tyr Pro Ser Ile Ser Leu Leu Asn His Ser Cys 195 200 205Asp Pro Asn Cys Ser Ile Val Phe Asn Gly Pro His Leu Leu Leu Arg 210 215 220Ala Val Arg Asp Ile Glu Val Gly Glu Glu Leu Thr Ile Cys Tyr Leu225 230 235 240Asp Met Leu Met Thr Ser Glu Glu Arg Arg Lys Gln Leu Arg Asp Gln 245 250 255Tyr Cys Phe Glu Cys Asp Cys Phe Arg Cys Gln Thr Gln Asp Lys Asp 260 265 270Ala Asp Met Leu Thr Gly Asp Glu Gln Val Trp Lys Glu Val Gln Glu 275 280 285Ser Leu Lys Lys Ile Glu Glu Leu Lys Ala His Trp Lys Trp Glu Gln 290 295 300Val Leu Ala Met Cys Gln Ala Ile Ile Ser Ser Asn Ser Glu Arg Leu305 310 315 320Pro Asp Ile Asn Ile Tyr Gln Leu Lys Val Leu Asp Cys Ala Met Asp 325 330 335Ala Cys Ile Asn Leu Gly Leu Leu Glu Glu Ala Leu Phe Tyr Gly Thr 340 345 350Arg Thr Met Glu Pro Tyr Arg Ile Phe Phe Pro Gly Ser His Pro Val 355 360 365Arg Gly Val Gln Val Met Lys Val Gly Lys Leu Gln Leu His Gln Gly 370 375 380Met Phe Pro Gln Ala Met Lys Asn Leu Arg Leu Ala Phe Asp Ile Met385 390 395 400Arg Val Thr His Gly Arg Glu His Ser Leu Ile Glu Asp Leu Ile Leu 405 410 415Leu Leu Glu Glu Cys Asp Ala Asn Ile Arg Ala Ser 420 425329PRTArtificial Sequencesynthesized proteinMISC_FEATUREC-terminal amide cap 3Ala Arg Thr Lys Gln Thr Ala Arg Lys Ser Thr Gly Gly Lys Ala Pro1 5 10 15Arg Lys Gln Leu Ala Thr Lys Ala Ala Arg Lys Ser Ala 20 25

Најкомплетнија база лековитог биља подржана науком

  • Ради на 55 језика
  • Биљни лекови потпомогнути науком
  • Препознавање биљака по слици
  • Интерактивна ГПС мапа - означите биље на локацији (ускоро)
  • Читајте научне публикације повезане са вашом претрагом
  • Претражите лековито биље по њиховим ефектима
  • Организујте своја интересовања и будите у току са истраживањем вести, клиничким испитивањима и патентима

Упишите симптом или болест и прочитајте о биљкама које би могле да помогну, укуцајте неку биљку и погледајте болести и симптоме против којих се користи.
* Све информације се заснивају на објављеним научним истраживањима

Google Play badgeApp Store badge