halophila ovalis/l цистеїн

Посилання зберігається в буфері обміну

СтаттіКлінічні випробуванняПатенти

Виберіть тип сортування

5 результати

Sequence-specific assignment of the 1H and 15N nuclear magnetic resonance spectra of the reduced recombinant high-potential iron-sulfur protein I from Ectothiorhodospira halophila.

Тільки зареєстровані користувачі можуть перекладати статті

Увійти Зареєструватися

A 1H and 15N NMR investigation through two-dimensional and three-dimensional spectroscopy has been performed on the reduced form ([Fe4S4]2+) of the recombinant high-potential iron-sulfur protein (HiPIP) I from Ectothiorhodospira halophila expressed in Escherichia coli. [Fe4S4]2+ clusters in proteins

The solution structure refinement of the paramagnetic reduced high-potential iron-sulfur protein I from Ectothiorhodospira halophila by using stable isotope labeling and nuclear relaxation.

Тільки зареєстровані користувачі можуть перекладати статті

Увійти Зареєструватися

The reduced high-potential iron sulfur protein I from Ectothiorhodospira halophila which contains the [4Fe-4S]2+ polymetallic center has been fully labeled with 15N and 13C. The protein is paramagnetic, the nuclear relaxation times of nuclei close to the paramagnetic ion are drastically shortened

Heterologous production of Halorhodospira halophila holo-photoactive yellow protein through tandem expression of the postulated biosynthetic genes.

Тільки зареєстровані користувачі можуть перекладати статті

Увійти Зареєструватися

The photoactive yellow protein (PYP) is a bacterial photoreceptor which is the structural prototype for the PAS domain superfamily of regulators and receptors. PYP is known to have a unique p-hydroxycinnamic acid chromophore, covalently attached to a cysteine. To date, it has not been shown how

Site-specific mutations provide new insights into the origin of pH effects and alternative spectral forms in the photoactive yellow protein from Halorhodospira halophila.

Тільки зареєстровані користувачі можуть перекладати статті

Увійти Зареєструватися

Acid/base titrations of wild-type PYP and mutants, either in buffer or in the presence of chaotropes such as thiocyanate, establish the presence of four spectral forms including the following: a neutral form (446-476 nm), an acidic form (350-355 nm), an alkaline form (430-440 nm), and an

Primary structure of a photoactive yellow protein from the phototrophic bacterium Ectothiorhodospira halophila, with evidence for the mass and the binding site of the chromophore.

Тільки зареєстровані користувачі можуть перекладати статті

Увійти Зареєструватися

The complete amino acid sequence of the 125-residue photoactive yellow protein (PYP) from Ectothiorhodospira halophila has been determined to be MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKEVIGKNFFKDVAP+ ++ CTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV. This is the first

Приєднуйтесь до нашої
сторінки у Facebook

Herbal & Natural Medicine

Найповніша база даних про лікарські трави, підкріплена наукою

Працює 55 мовами
Лікування травами за підтримки науки
Розпізнавання трав за зображенням
Інтерактивна GPS-карта - позначайте трави на місці (скоро)
Читайте наукові публікації, пов’язані з вашим пошуком
Шукайте лікарські трави за їх впливом
Організуйте свої інтереси та будьте в курсі новинних досліджень, клінічних випробувань та патентів

Введіть симптом або хворобу та прочитайте про трави, які можуть допомогти, наберіть траву та ознайомтесь із захворюваннями та симптомами, проти яких вона застосовується.
* Вся інформація базується на опублікованих наукових дослідженнях