Production of fragrant compounds
关键词
专利信息
专利号 | 10337031 |
已提起 | 04/10/2016 |
专利日期 | 07/01/2019 |
抽象
索偿
The invention claimed is:
1. A method of producing one or more sesquiterpenes comprising (+)-cedrol and/or (-)-thujopsene, the method comprising: a. contacting an acyclic farnesyl diphosphate (FPP) precursor with a polypeptide having a (+)-cedrol synthase activity and/or a (-)-thujopsene synthase activity wherein the polypeptide comprises: i. a sequence of amino acids that has at least 90% sequence identity to a polypeptide selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 and SEQ ID NO: 14; or ii. a sequence of amino acids selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 and SEQ ID NO: 14, to produce one or more sesquiterpenes comprising (+)-cedrol and/or (-)-thujopsene; and b. optionally isolating the (+)-cedrol and/or (-)-thujopsene.
2. The method as recited in claim 1 further comprising transforming a host cell or non-human host organism with a nucleic acid encoding a polypeptide having a (+)-cedrol and/or (-)-thujopsene activity wherein the polypeptide comprises: a. a sequence of amino acids that has at least 90% sequence identity to SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 or SEQ ID NO: 14; or b. a sequence of amino acids comprising SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 or SEQ ID NO: 14, and wherein the method further comprises culturing the host cell or organism under conditions that allow for the production of the polypeptide.
3. The method as recited in claim 1 further comprising cultivating a non-human host organism or cell capable of producing FPP and transformed to express a polypeptide wherein the polypeptide comprises: a. a sequence of amino acids that has at least 90% sequence identity to SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 or SEQ ID NO: 14; or b. a sequence of amino acids comprising SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 or SEQ ID NO: 14, and wherein said cultivating is done under conditions conducive to the production of (+)-cedrol or (-)-thujopsene.
4. The method as recited in claim 3, wherein the cell is a prokaryotic cell, a bacterial cell, or a eukaryotic cell.
5. The method as recited in claim 4, wherein the eukaryotic cell is a yeast cell or a plant cell.
6. The method of claim 1 further comprising processing the (+)-cedrol to a derivative using a chemical or biochemical synthesis or a combination of both.
7. The method of claim 1 further comprising contacting the (+)-cedrol with at least one enzyme to produce a (+)-cedrol derivative.
8. The method of claim 1 further comprising converting the (-)-thujopsene to a (-)-thujopsene derivative using a chemical or biochemical synthesis or a combination of both.
9. The method of claim 1 further comprising contacting the (-)-thujopsene with at least one enzyme to produce a thujopsene derivative.
10. The method of claim 1, wherein the polypeptide comprises: a. a sequence of amino acids that has at least 90% 95% sequence identity to SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO: 13; or b. a sequence of amino acids comprising SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO: 13, and wherein the main sesquiterpene compound produced is (+)-cedrol.
11. The method of claim 1, wherein the polypeptide comprises: a. a sequence of amino acids that has at least 90% sequence identity to SEQ ID NO:4 or SEQ ID NO: 14; or b. a sequence of amino acids comprising SEQ ID NO:4 or SEQ ID NO: 14, and wherein the main sesquiterpene compound produced is (-)-thujopsene.
描述
RELATED APPLICATIONS
This application is a national stage application filing under 35 U.S.C. .sctn. 371 of International Patent Application PCT/CN2016/078956, filed Apr. 11, 2016, which claims the benefit of European patent application PCT/EP2015/057792 filed Apr. 9, 2015.
SUBMISSION OF SEQUENCE LISTING
The Sequence Listing associated with this application is filed in electronic format via EFS-Web and hereby incorporated by reference into the specification in its entirety. The name of the text file containing the Sequence Listing is 9340US_SequenceListing. The size of the text file is 62 KB, and the text file was created on Oct. 4, 2017.
TECHNICAL FIELD
The field relates to nucleic acids, enzymes, vectors and cells used in methods to produce terpenes such as (+)-cedrol and (-)-thujopsene.
BACKGROUND
Terpenes are found in most organisms (microorganisms, animals and plants). These compounds are made up of five carbon units called isoprene units and are classified by the number of these units present in their structure. Thus monoterpenes, sesquiterpenes and diterpenes are terpenes containing 10, 15 and 20 carbon atoms respectively. Sesquiterpenes, for example, are widely found in the plant kingdom. Many sesquiterpene molecules are known for their flavor and fragrance properties and their cosmetic, medicinal and antimicrobial effects. Numerous sesquiterpene hydrocarbons and sesquiterpenoids have been identified.
Biosynthetic production of terpenes involves enzymes called terpene synthases. Sesquiterpene synthases are present in the plant kingdom and use the substrate farnesyl pyrophosphate (FPP) but they have different product profiles. Genes and cDNAs encoding sesquiterpene synthases have been cloned and the corresponding recombinant enzymes characterized.
Current sources for (+)-cedrol are conifers containing cedar oil. Current sources for (-)-thujopsene are conifers such as Juniperus cedrus and Thujopsis dolabrata.
SUMMARY
Provided herein is an isolate from Juniperus virginiana, Platycladus orientalis `Beverleyensis` or Platycladus orientalis comprising (+)-cedrol or (-)-thujopsene synthase.
Further provided herein is an isolated nucleic acid molecule from Juniperus virginiana, Platycladus orientalis `Beverleyensis` or Platycladus orientalis encoding a (+)-cedrol or (-)-thujopsene synthase.
Further provided herein is a method of producing (+)-cedrol or (-)-thujopsene comprising: a. contacting an acyclic farnesyl diphosphate (FPP) precursor with a polypeptide having an activity selected from the group consisting of a (+)-cedrol synthase activity and a (-)-thujopsene synthase activity wherein the polypeptide comprises: i. a sequence of amino acids that has at least 70%, 75%, 80%, 85%, 90%, 95%, 98% and/or 99% sequence identity to a polypeptide selected from the group consisting of SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 and SEQ ID NO: 14; or ii. a sequence of amino acids selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 and SEQ ID NO: 14; to produce a compound selected from the group consisting of (+)-cedrol and (-)-thujopsene; and b. optionally isolating the (+)-cedrol and/or the (-)-thujopsene provided that when the polypeptide comprises: i. a sequence of amino acids that has at least 70%, 75%, 80%, 85%, 90%, 95%, 98% and/or 99% sequence identity to a sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO: 13; or ii. a sequence of amino acids selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO: 13; the compound produced is (+)-cedrol in the absence of (-)-thujopsene. Also provided herein is a polypeptide wherein the polypeptide comprises: a) a sequence of amino acids that has at least 70%, 75%, 80%, 85%, 90%, 95%, 98% and/or 99% sequence identity to a polypeptide selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 and SEQ ID NO: 14; or b) a sequence of amino acids selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 and SEQ ID NO: 14; Also provided herein is a nucleic acid encoding a polypeptide described above. Also provided herein is a nucleic acid comprising: a. a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, and/or 99% similar or at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, and/or 99% identical to a nucleotide sequence selected from the group consisting of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO:12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO: 19; or b. a nucleotide sequence selected from the group consisting of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO:12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO: 19.
DESCRIPTION OF THE DRAWINGS
FIG. 1. GCMS analysis of the aerial and underground parts of Juniperus Virginiana seedlings (1-2 years-old). The peak of (+)-cedrol is indicated.
FIG. 2. GCMS analysis of the sesquiterpene mixture produce in an in-vitro assay by 4 different J. virginiana sesquiterpene synthases, JvCP1206-4, JvCP1206-3, JV1206-6 and JvCP1206-5. The peaks corresponding to (+)-cedrol and (-)-thujopsene are indicated.
FIG. 3. GCMS analysis of the sesquiterpene mixture produce in-vivo by engineered bacteria cells expressing four different J. virginiana sesquiterpene synthases, JvCP1206-4, JvCP1206-3, JV1206-6 and JvCP1206-5. The peaks corresponding to (+)-cedrol and (-)-thujopsene are indicated.
FIG. 4. Structure of (+)-cedrol and (-)-thujopsene produced by the recombinant J. virginiana sesquiterpene synthases.
FIG. 5. GC/MS chromatogram of P. orientalis `Beverleyensis` leaves dichloromethane extract (only the zone for sesquiterpenes is displayed). The arrow denotes the peak of (+)-cedrol.
FIG. 6. Mass spectrum of the peak of (+)-cedrol in FIG. 5
FIG. 7. GC/MS chromatogram of P. orientalis leaves dichloromethane extract (only the zone for sesquiterpenes is displayed). The arrow denotes the peak of (-)-thujopsene.
FIG. 8. Mass spectrum of the peak of (-)-thujopsene in FIG. 7.
FIG. 9. GC/MS chromatogram of the E. coli expression experiment of PorB1 (only the zone for sesquiterpene is displayed). Arrow denotes the peak of (+)-cedrol.
FIG. 10. Mass spectrum of the peak of (+)-cedrol in FIG. 9.
FIG. 11. GC/MS chromatogram of the E. coli expression experiment of Por2-3-5 (only the zone for sesquiterpene is displayed). Arrow denotes the peak of (-)-thujopsene.
FIG. 12. Mass spectrum of the peak of (-)-thujopsene in FIG. 11.
DETAILED DESCRIPTION
For the descriptions herein and the appended claims, the use of "or" means "and/or" unless stated otherwise. Similarly, "comprise," "comprises," "comprising" "include," "includes," and "including" are interchangeable and not intended to be limiting.
It is to be further understood that where descriptions of various embodiments use the term "comprising," those skilled in the art would understand that in some specific instances, an embodiment can be alternatively described using language "consisting essentially of" or "consisting of.
In one embodiment a method provided herein comprises the steps of transforming a host cell or non-human organism with a nucleic acid encoding a polypeptide having a (+)-cedrol synthase or a (-)-thujopsene synthase activity wherein the polypeptide comprises: a. a sequence of amino acids that has at least 70%, 75%, 80%, 85%, 90%, 95%, 98% and/or 99% sequence identity to a polypeptide selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 and SEQ ID NO: 14; or b. a sequence of amino acids selected from the group consisting SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 and SEQ ID NO: 14; and culturing the host cell or organism under conditions that allow for the production of the polypeptide.
In another embodiment a method provided herein further comprises cultivating a non-human host organism or cell capable of producing FPP and transformed to express a polypeptide wherein the polypeptide comprises: a. a sequence of amino acids that has at least 70%, 75%, 80%, 85%, 90%, 95%, 98% and/or 99% sequence identity to a sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 and SEQ ID NO: 14; or b. a sequence of amino acids selected from the group consisting of SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:13 and SEQ ID NO: 14; under conditions conducive to the production of (+)-cedrol or (-)-thujopsene.
In another embodiment, provided herein is an expression vector comprising the nucleic acid described herein.
In another embodiment, provided herein is a non-human host organism or cell transformed to harbor at least one nucleic acid described herein so that it heterologously expresses or over-expresses at least one polypeptide described herein.
In one embodiment, the non-human host organism provided herein is a plant, a prokaryote or a fungus.
In one embodiment, the non-human host provided herein is a microorganism, particularly a bacteria or yeast.
In one embodiment, the non-human organism provided herein is E. coli and said yeast is Saccharomyces cerevisiae.
In one embodiment, the non-human organism provided herein is Saccharomyces cerevisiae.
In one embodiment, the cell is a prokaryotic cell.
In another embodiment the cell is a bacterial cell.
In one embodiment the cell is a eukaryotic cell.
In one embodiment the eukaryotic cell is a yeast cell or a plant cell.
In another embodiment a method provided herein further comprising processing the (+)-cedrol to a derivative using a chemical or biochemical synthesis or a combination of both.
In another embodiment a method provided herein further comprising contacting the (+)-cedrol with at least one enzyme to produce a (+)-cedrol derivative.
In another embodiment a method provided herein comprises converting the (-)-thujopsene to a (-)-thujopsene derivative using a chemical or biochemical synthesis or a combination of both.
In another embodiment a method provided herein further comprises contacting the (-)-thujopsene with at least one enzyme to produce a thujopsene derivative.
The ability of a polypeptide to catalyze the synthesis of a particular sesquiterpene (for example a (+)-cedrol synthase and/or a (-)-thujopsene synthase) can be simply confirmed by performing the enzyme assay as detailed in the Examples provided herein.
Polypeptides are also meant to include truncated polypeptides provided that they keep their (+)-cedrol synthase activity and/or their (-)-thujopsene synthase activity.
As intended herein below, a nucleotide sequence obtained by modifying the sequences described herein may be obtained using any method known in the art, for example by introducing any type of mutations such as deletion, insertion or substitution mutations. Examples of such methods are cited in the part of the description relative to the variant polypeptides and the methods to prepare them.
The percentage of identity between two peptidic or nucleotidic sequences is a function of the number of amino acids or nucleotide residues that are identical in the two sequences when an alignment of these two sequences has been generated. Identical residues are defined as residues that are the same in the two sequences in a given position of the alignment. The percentage of sequence identity, as used herein, is calculated from the optimal alignment by taking the number of residues identical between two sequences dividing it by the total number of residues in the shortest sequence and multiplying by 100. The optimal alignment is the alignment in which the percentage of identity is the highest possible. Gaps may be introduced into one or both sequences in one or more positions of the alignment to obtain the optimal alignment. These gaps are then taken into account as non-identical residues for the calculation of the percentage of sequence identity. Alignment for the purpose of determining the percentage of amino acid or nucleic acid sequence identity can be achieved in various ways using computer programs and for instance publicly available computer programs available on the World Wide Web. Preferably, the BLAST program (Tatiana et al, FEMS Microbiol Lett., 1999, 174:247-250, 1999) set to the default parameters, available from the National Center for Biotechnology Information (NCBI) at http://www.ncbi.nlm.nih.gov/BLAST/bl2seq/wblast2.cgi, can be used to obtain an optimal alignment of peptidic or nucleotidic sequences and to calculate the percentage of sequence identity.
ABBREVIATIONS USED
bp base pair kb kilo base DNA deoxyribonucleic acid cDNA complementary DNA DTT dithiothreitol FPP farnesyl pyrophosphate GC gaseous chromatograph IPTG isopropyl-D-thiogalacto-pyranoside LB lysogeny broth MS mass spectrometer MVA mevalonic acid PCR polymerase chain reaction RNA ribonucleic acid mRNA messenger RNA miRNA micro RNA siRNA small interfering RNA rRNA ribosomal RNA tRNA transfer RNA
DEFINITIONS
The term "polypeptide" means an amino acid sequence of consecutively polymerized amino acid residues, for instance, at least 15 residues, at least 30 residues, at least 50 residues. In some embodiments provided herein, a polypeptide comprises an amino acid sequence that is an enzyme, or a fragment, or a variant thereof.
The term "isolated" polypeptide refers to an amino acid sequence that is removed from its natural environment by any method or combination of methods known in the art and includes recombinant, biochemical and synthetic methods.
The term "protein" refers to an amino acid sequence of any length wherein amino acids are linked by covalent peptide bonds, and includes oligopeptide, peptide, polypeptide and full length protein whether naturally occurring or synthetic.
The terms "(+)-cedrol synthase", "(-)-thujopsene synthase", "(+)-cedrol synthase activity", "(-)-thujopsene synthase activity" "(+)-cedrol synthase protein" and "(-)-thujopsene synthase protein" refer to enzymes capable of converting farnesyl diphosphate (FPP) to (+)-cedrol or to (-)-thujopsene.
The terms "biological function," "function," "biological activity" or "activity" refer to the ability of the (+)-cedrol synthase and (-)-thujopsene synthase to catalyze the formation of (+)-cedrol and (-)-thujopsene from FPP.
The terms "nucleic acid sequence," "nucleic acid," and "polynucleotide" are used interchangeably meaning a sequence of nucleotides. A nucleic acid sequence may be a single-stranded or double-stranded deoxyribonucleotide, or ribonucleotide of any length, and include coding and non-coding sequences of a gene, exons, introns, sense and anti-sense complimentary sequences, genomic DNA, cDNA, miRNA, siRNA, mRNA, rRNA, tRNA, recombinant nucleic acid sequences, isolated and purified naturally occurring DNA and/or RNA sequences, synthetic DNA and RNA sequences, fragments, primers and nucleic acid probes. The skilled artisan is aware that the nucleic acid sequences of RNA are identical to the DNA sequences with the difference of thymine (T) being replaced by uracil (U).
An "isolated nucleic acid" or "isolated nucleic acid sequence" is defined as a nucleic acid or nucleic acid sequence that is in an environment different from that in which the nucleic acid or nucleic acid sequence naturally occurs. The term "naturally-occurring" as used herein as applied to a nucleic acid refers to a nucleic acid that is found in a cell in nature. For example, a nucleic acid sequence that is present in an organism, for instance in the cells of an organism, that can be isolated from a source in nature and which it has not been intentionally modified by a human in the laboratory is naturally occurring.
"Recombinant nucleic acid sequences" are nucleic acid sequences that result from the use of laboratory methods (molecular cloning) to bring together genetic material from more than one source, creating a nucleic acid sequence that does not occur naturally and would not be otherwise found in biological organisms.
"Recombinant DNA technology" refers to molecular biology procedures to prepare a recombinant nucleic acid sequence as described, for instance, in Laboratory Manuals edited by Weigel and Glazebrook, 2002 Cold Spring Harbor Lab Press; and Sambrook et al., 1989 Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press.
The term "gene" means a DNA sequence comprising a region, which is transcribed into a RNA molecule, e.g., an mRNA in a cell, operably linked to suitable regulatory regions, e.g., a promoter. A gene may thus comprise several operably linked sequences, such as a promoter, a 5' leader sequence comprising, e.g., sequences involved in translation initiation, a coding region of cDNA or genomic DNA, introns, exons, and/or a 3'non-translated sequence comprising, e.g., transcription termination sites.
A "chimeric gene" refers to any gene, which is not normally found in nature in a species, in particular, a gene in which one or more parts of the nucleic acid sequence are present that are not associated with each other in nature. For example the promoter is not associated in nature with part or all of the transcribed region or with another regulatory region. The term "chimeric gene" is understood to include expression constructs in which a promoter or transcription regulatory sequence is operably linked to one or more coding sequences or to an antisense, i.e., reverse complement of the sense strand, or inverted repeat sequence (sense and antisense, whereby the RNA transcript forms double stranded RNA upon transcription). The term "chimeric gene" also includes genes obtained through the combination of portions of one or more coding sequences to produce a new gene.
A "3' UTR" or "3' non-translated sequence" (also referred to as "3' untranslated region," or "3'end") refers to the nucleic acid sequence found downstream of the coding sequence of a gene, which comprises for example a transcription termination site and (in most, but not all eukaryotic mRNAs) a polyadenylation signal such as AAUAAA or variants thereof. After termination of transcription, the mRNA transcript may be cleaved downstream of the polyadenylation signal and a poly(A) tail may be added, which is involved in the transport of the mRNA to the site of translation, e.g., cytoplasm.
"Expression of a gene" involves transcription of the gene and translation of the mRNA into a protein. Overexpression refers to the production of the gene product as measured by levels of mRNA, polypeptide and/or enzyme activity in transgenic cells or organisms that exceeds levels of production in non-transformed cells or organisms of a similar genetic background.
"Expression vector" as used herein means a nucleic acid molecule engineered using molecular biology methods and recombinant DNA technology for delivery of foreign or exogenous DNA into a host cell. The expression vector typically includes sequences required for proper transcription of the nucleotide sequence. The coding region usually codes for a protein of interest but may also code for an RNA, e.g., an antisense RNA, siRNA and the like.
An "expression vector" as used herein includes any linear or circular recombinant vector including but not limited to viral vectors, bacteriophages and plasmids. The skilled person is capable of selecting a suitable vector according to the expression system. In one embodiment, the expression vector includes the nucleic acid of an embodiment herein operably linked to at least one regulatory sequence, which controls transcription, translation, initiation and termination, such as a transcriptional promoter, operator or enhancer, or an mRNA ribosomal binding site and, optionally, including at least one selection marker. Nucleotide sequences are "operably linked" when the regulatory sequence functionally relates to the nucleic acid of an embodiment herein. "Regulatory sequence" refers to a nucleic acid sequence that determines expression level of the nucleic acid sequences of an embodiment herein and is capable of regulating the rate of transcription of the nucleic acid sequence operably linked to the regulatory sequence. Regulatory sequences comprise promoters, enhancers, transcription factors, promoter elements and the like.
"Promoter" refers to a nucleic acid sequence that controls the expression of a coding sequence by providing a binding site for RNA polymerase and other factors required for proper transcription including without limitation transcription factor binding sites, repressor and activator protein binding sites. The meaning of the term promoter also includes the term "promoter regulatory sequence". Promoter regulatory sequences may include upstream and downstream elements that may influences transcription, RNA processing or stability of the associated coding nucleic acid sequence. Promoters include naturally-derived and synthetic sequences. The coding nucleic acid sequences is usually located downstream of the promoter with respect to the direction of the transcription starting at the transcription initiation site.
The term "constitutive promoter" refers to an unregulated promoter that allows for continual transcription of the nucleic acid sequence it is operably linked to.
As used herein, the term "operably linked" refers to a linkage of polynucleotide elements in a functional relationship. A nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence. For instance, a promoter, or rather a transcription regulatory sequence, is operably linked to a coding sequence if it affects the transcription of the coding sequence. Operably linked means that the DNA sequences being linked are typically contiguous. The nucleotide sequence associated with the promoter sequence may be of homologous or heterologous origin with respect to the host organism or cell, e.g. plant, bacteria or yeast cells, to be transformed. The sequence also may be entirely or partially synthetic. Regardless of the origin, the nucleic acid sequence associated with the promoter sequence will be expressed or silenced in accordance with promoter properties to which it is linked. The associated nucleic acid may code for a protein that is desired to be expressed or suppressed throughout the organism at all times or, alternatively, at a specific time or in specific tissues, cells, or cell compartment. Such nucleotide sequences particularly encode proteins conferring desirable phenotypic traits to the host cells or organism altered or transformed therewith. More particularly, the associated nucleotide sequence leads to the production of a (+)-cedrol synthase and/or of a (-)-thujopsene synthase in the organism. Particularly, the nucleotide sequence encodes a (+)-cedrol synthase and/or a (-)-thujopsene synthase.
"Target peptide" refers to an amino acid sequence which targets a protein, or polypeptide to intracellular organelles, i.e., mitochondria, or plastids, or to the extracellular space (secretion signal peptide). A nucleic acid sequence encoding a target peptide may be fused to the nucleic acid sequence encoding the amino terminal end, e.g., N-terminal end, of the protein or polypeptide, or may be used to replace a native targeting polypeptide.
The term "primer" refers to a short nucleic acid sequence that is hybridized to a template nucleic acid sequence and is used for polymerization of a nucleic acid sequence complementary to the template.
As used herein, the term "host cell" or "transformed cell" refers to a cell (or organism) altered to harbor at least one nucleic acid molecule, for instance, a recombinant gene encoding a desired protein or nucleic acid sequence which upon transcription yields a (+)-cedrol synthase protein or a (-)-thujopsene synthase protein useful to produce (+)-cedrol and/or (-)-thujopsene. The host cell is particularly a bacterial cell, a fungal cell or a plant cell. The host cell may contain a recombinant gene which has been integrated into the nuclear or organelle genomes of the host cell. Alternatively, the host may contain the recombinant gene extra-chromosomally. Homologous sequences include orthologous or paralogous sequences. Methods of identifying orthologs or paralogs including phylogenetic methods, sequence similarity and hybridization methods are known in the art and are described herein.
Paralogs result from gene duplication that gives rise to two or more genes with similar sequences and similar functions. Paralogs typically cluster together and are formed by duplications of genes within related e.g. plant species. Paralogs are found in groups of similar genes using pair-wise Blast analysis or during phylogenetic analysis of gene families using programs such as CLUSTAL. In paralogs, consensus sequences can be identified characteristic to sequences within related genes and having similar functions of the genes.
Orthologs, or orthologous sequences, are sequences similar to each other because they are found in species that descended from a common ancestor. For instance, plant species that have common ancestors are known to contain many enzymes that have similar sequences and functions. The skilled artisan can identify orthologous sequences and predict the functions of the orthologs, for example, by constructing a polygenic tree for a gene family of one species using CLUSTAL or BLAST programs
The term "selectable marker" refers to any gene which upon expression may be used to select a cell or cells that include the selectable marker. Examples of selectable markers are described below. The skilled artisan will know that different antibiotic, fungicide, auxotrophic or herbicide selectable markers are applicable to different target species.
The term "organism" refers to any non-human multicellular or unicellular organisms such as a plant, or a microorganism. Particularly, a micro-organism is a bacterium, a yeast, an algae or a fungus.
The term "plant" is used interchangeably to include plant cells including plant protoplasts, plant tissues, plant cell tissue cultures giving rise to regenerated plants, or parts of plants, or plant organs such as roots, stems, leaves, flowers, pollen, ovules, embryos, fruits and the like. Any plant can be used to carry out the methods of an embodiment herein.
The polypeptide to be contacted with an acyclic pyrophosphate, e.g. FPP, in vitro can be obtained by extraction from any organism expressing it, using standard protein or enzyme extraction technologies. If the host organism is an unicellular organism or cell releasing the polypeptide of an embodiment herein into the culture medium, the polypeptide may simply be collected from the culture medium, for example by centrifugation, optionally followed by washing steps and re-suspension in suitable buffer solutions. If the organism or cell accumulates the polypeptide within its cells, the polypeptide may be obtained by disruption or lysis of the cells and further extraction of the polypeptide from the cell lysate.
The polypeptide having a (+)-cedrol synthase activity and/or a (-)-thujopsene synthase activity, either in an isolated form or together with other proteins, for example in a crude protein extract obtained from cultured cells or microorganisms, may then be suspended in a buffer solution at optimal pH. If adequate, salts, DTT, inorganic cations and other kinds of enzymatic co-factors, may be added in order to optimize enzyme activity. The precursor FPP may be added to the polypeptide suspension, which is then incubated at optimal temperature, for example between 15 and 40.degree. C., particularly between 25 and 35.degree. C., more particularly at 30.degree. C. After incubation, the (+)-cedrol and/or a (-)-thujopsene produced may be isolated from the incubated solution by standard isolation procedures, such as solvent extraction and distillation, optionally after removal of polypeptides from the solution.
According to another particular embodiment, the method of any of the above-described embodiments is carried out in vivo. In one aspect, an embodiment comprises cultivating a non-human host organism or cell capable of producing FPP and transformed to express at least one polypeptide comprising an amino acid sequence at least 70% identical to a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 SEQ ID NO: 4, SEQ ID NO: 13 and SEQ ID NO: 14 and having a (+)-cedrol synthase activity and/or (-)-thujopsene synthase activity, under conditions conducive to the production of (+)-cedrol and/or (-)-thujopsene.
According to a more particular embodiment, the method further comprises transforming a non-human organism or cell capable of producing FPP with at least one nucleic acid encoding a polypeptide comprising an amino acid sequence at least 70% identical to a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 13 and SEQ ID NO: 14 and having a (+)-cedrol synthase activity and/or a (-)-thujopsene synthase activity, so that said organism expresses said polypeptide.
These embodiments provided herein are particularly advantageous since it is possible to carry out the method in vivo without previously isolating the polypeptide. The reaction occurs directly within the organism or cell transformed to express said polypeptide.
According to a more particular embodiment at least one nucleic acid used herein comprises a nucleotide sequence that has been obtained by modifying SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 SEQ ID SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19 or the complement thereof.
The organism or cell is meant to "express" a polypeptide, provided that the organism or cell is transformed to harbor a nucleic acid encoding said polypeptide, this nucleic acid is transcribed to mRNA and the polypeptide is found in the host organism or cell. The term "express" encompasses "heterologously express" and "over-express", the latter referring to levels of mRNA, polypeptide and/or enzyme activity over and above what is measured in a non-transformed organism or cell. A more detailed description of suitable methods to transform a non-human host organism or cell will be described later on in the part of the specification that is dedicated to such transformed non-human host organisms or cells.
A particular organism or cell is meant to be "capable of producing FPP" when it produces FPP naturally or when it does not produce FPP naturally but is transformed to produce FPP, either prior to the transformation with a nucleic acid as described herein or together with said nucleic acid. Organisms or cells transformed to produce a higher amount of FPP than the naturally occurring organism or cell are also encompassed by the "organisms or cells capable of producing FPP". Methods to transform organisms, for example microorganisms, so that they produce FPP are already known in the art.
To carry out an embodiment herein in vivo, the host organism or cell is cultivated under conditions conducive to the production of a (+)-cedrol synthase and/or a (-)-thujopsene synthase. Accordingly, if the host is a transgenic plant, optimal growth conditions are provided, such as optimal light, water and nutrient conditions, for example. If the host is a unicellular organism, conditions conducive to the production of a (+)-cedrol synthase and/or a (-)-thujopsene synthase may comprise addition of suitable cofactors to the culture medium of the host. In addition, a culture medium may be selected, so as to maximize (+)-cedrol synthase activity and/or a (-)-thujopsene synthase activity. Optimal culture conditions are described in a more detailed manner in the following Examples.
Non-human host organisms suitable to carry out the method of an embodiment herein in vivo may be any non-human multicellular or unicellular organisms. In a particular embodiment, the non-human host organism used to carry out an embodiment herein in vivo is a plant, a prokaryote or a fungus. Any plant, prokaryote or fungus can be used. Particularly useful plants are those that naturally produce high amounts of terpenes. In a more particular embodiment the non-human host organism used to carry out the method of an embodiment herein in vivo is a microorganism. Any microorganism can be used but according to an even more particular embodiment said microorganism is a bacteria or yeast. Most particularly, said bacteria is E. coli and said yeast is Saccharomyces cerevisiae.
Some of these organisms do not produce FPP naturally or only in small amounts. To be suitable to carry out the method of an embodiment herein, these organisms have to be transformed to produce said precursor or to produce said precursor in larger amounts. They can be so transformed either before the modification with the nucleic acid described according to any of the above embodiments or simultaneously, as explained above.
Isolated higher eukaryotic cells can also be used, instead of complete organisms, as hosts to carry out the method of an embodiment herein in vivo. Suitable eukaryotic cells may be any non-human cell, but are particularly plant or fungal cells.
In another particular embodiment the polypeptide comprises: c. a sequence of amino acids that has at least 70%, 75%, 80%, 85%, 90%, 95%, 98% and/or 99% sequence identity to a polypeptide selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 and SEQ ID NO: 14; or d. a sequence of amino acids selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO: 13 and SEQ ID NO: 14.
According to another particular embodiment, the at least one polypeptide having a (+)-cedrol synthase activity and/or a (-)-thujopsene synthase activity used in any of the embodiments described herein or encoded by the nucleic acid described herein comprises an amino acid sequence that is a variant of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 13 or SEQ ID NO: 14 obtained by genetic engineering, provided that said variant keeps its (+)-cedrol synthase activity and/or its (-)-thujopsene synthase activity.
As used herein, the polypeptide is intended as a polypeptide or peptide fragment that encompasses the amino acid sequences identified herein, as well as truncated or variant polypeptides, provided that they keep their (+)-cedrol synthase activity and/or a (-)-thujopsene synthase activity as defined above and that they share at least the defined percentage of identity with the corresponding fragment of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 13 or SEQ ID NO: 14.
A fragment of a polypeptide described herein may comprise, for example, at least 50%, 60%, 70%, 80%, 90%, 95% or 99% of the polypeptide amino acid sequence described herein.
Examples of variant polypeptides are naturally occurring proteins that result from alternate mRNA splicing events or from proteolytic cleavage of the polypeptides described herein. Variations attributable to proteolysis include, for example, differences in the N- or C-termini upon expression in different types of host cells, due to proteolytic removal of one or more terminal amino acids from the polypeptides of an embodiment herein. Polypeptides encoded by a nucleic acid obtained by natural or artificial mutation of a nucleic acid of an embodiment herein, as described thereafter, are also encompassed by an embodiment herein.
Polypeptide variants resulting from a fusion of additional peptide sequences at the amino and carboxyl terminal ends can also be used in the methods of an embodiment herein. In particular such a fusion can enhance expression of the polypeptides, be useful in the purification of the protein or improve the enzymatic activity of the polypeptide in a desired environment or expression system. Such additional peptide sequences may be signal peptides, for example. Accordingly, encompassed herein are methods using variant polypeptides, such as those obtained by fusion with other oligo- or polypeptides and/or those which are linked to signal peptides. Polypeptides resulting from a fusion with another functional protein, such as another protein from the terpene biosynthesis pathway, can also be advantageously be used in the methods of an embodiment herein.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and even more particularly at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 13 and SEQ ID NO: 14.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and even more particularly at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 13 and SEQ ID NO: 14.
In a further embodiment, the polypeptide comprises an amino acid sequence at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and even more particularly at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 13 and SEQ ID NO: 14.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and even more particularly at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 13 and SEQ ID NO: 14.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 90%, particularly at least 95%, particularly at least 98%, and even more particularly at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 13 and SEQ ID NO: 14.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 95%, particularly at least 98%, and even more particularly at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 13 and SEQ ID NO: 14.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 98%, and even more particularly at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 13 and SEQ ID NO: 14.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 13 and SEQ ID NO: 14.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and even more particularly at least 99% identical to SEQ ID NO: 1.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and even more particularly at least 99% identical to SEQ ID NO: 2.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and even more particularly at least 99% identical to SEQ ID NO: 3.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and even more particularly at least 99% identical to SEQ ID NO: 4.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and even more particularly at least 99% identical to SEQ ID NO: 13.
According to a particular embodiment, the polypeptide comprises an amino acid sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and even more particularly at least 99% identical to SEQ ID NO: 14.
In one aspect, a polypeptide having a (+)-cedrol synthase activity and/or a (-)-thujopsene synthase activity may have a particular selectivity for (+)-cedrol or (-)-thujopsene product when the polypeptide is contacted with FPP as described herein. Selectivity for (+)-cedrol or (-)-thujopsene product as used herein refers to the amount of (+)-cedrol or (-)-thujopsene product produced compared to the total amount of sesquiterpene products, and is typically expressed as a percentage. Selectivity may be given for a particular gene expression system, e.g. an E. coli expression system.
In one aspect a polypeptide may produce (+)-cedrol as the major sesquiterpene product. For example, a polypeptide may have a selectivity for (+)-cedrol of about 70-90%, for example, 70% or more, 72% or more, 73% or more, 74% or more, 75% or more, 78% or more, 79% or more, 82% or more, 84% or more, 86% or more or 88% or more. Such selectivities may be obtained, for example, in an E. coli expression system such as those described in the present Examples. In one aspect, the polypeptide may produce (+)-cedrol in the absence of (-)-thujopsene.
In one aspect, a polypeptide may produce (-)-thujopsene as the major sesquiterpene product. For example, a polypeptide may have a selectivity for (-)-thujopsene product of about 15-60%, for example, 18% or more, 20% or more, 25% or more, 26% or more, 30% or more, 35% or more, 40% or more, 44% or more, 45% or more, 50% or more, 53% or more, 55% or more, or 57% or more. Such selectivities may be obtained, for example, in an E. coli expression system such as those described in the present Examples. In one aspect, the polypeptide may produce (-)-thujopsene in the absence of (+)-cedrol, or may produce (+)-cedrol in addition to (-)-thujopsene but in a lesser amount.
In one aspect, a polypeptide described herein which comprises: (i) a sequence of amino acids that has at least 70%, 75%, 80%, 85%, 90%, 95%, 98% and/or 99% sequence identity to a sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO: 13; or (ii) a sequence of amino acids selected from the group consisting of SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO: 13; produces (+)-cedrol as the major sesquiterpene product, and may have a selectivity for (+)-cedrol described herein above. Such a polypeptide may produce (+)-cedrol in the absence of (-)-thujopsene.
For example, the PorB1 polypeptide described herein, having the amino acid sequence in SEQ ID NO: 13 can achieve a selectivity for (+)-cedrol of about 88% and in the absence of (-)-thujopsene in an E. coli expression system. For example, the JvCP1206-4 polypeptide described herein, having the amino acid sequence in SEQ ID NO: 1 can achieve a selectivity for (+)-cedrol of about 75% and in the absence of (-)-thujopsene in an E. coli expression system. For example, the JvCP1206-6 polypeptide described herein, having the amino acid sequence in SEQ ID NO:3 can achieve a selectivity for (+)-cedrol of about 84% and in the absence of (-)-thujopsene in an E. coli expression system.
In one aspect, a polypeptide described herein which comprises (i) a sequence of amino acids that has at least 70%, 75%, 80%, 85%, 90%, 95%, 98% and/or 99% sequence identity to a sequence selected from the group consisting of SEQ ID NO: 4 and SEQ ID NO: 14; or (ii) a sequence of amino acids selected from the group consisting of SEQ ID NO:4, and SEQ ID NO: 14; produces (-)-thujopsene as the major sesquiterpene product, and may have a selectivity for (-)-thujopsene described herein above. Such a polypeptide may, for example, produce (-)-thujopsene in the absence of (+)-cedrol, or may produce (+)-cedrol in addition to (-)-thujopsene but in a lesser amount.
For example, the Por2-3-5 polypeptide described herein, having the amino acid sequence in SEQ ID NO: 14 can achieve a selectivity for (-)-thujopsene of about 57% in an E. coli expression system. For example, the JvCP1206-5 polypeptide described herein, having the amino acid sequence in SEQ ID NO: 4 can achieve a selectivity for (-)-thujopsene of about 26% in an E. coli expression system.
As mentioned above, the nucleic acid encoding the polypeptide of an embodiment herein is a useful tool to modify non-human host organisms or cells intended to be used when the method is carried out in vivo.
A nucleic acid encoding a polypeptide according to any of the above-described embodiments is therefore also provided herein.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to a sequence selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and more particularly at least 99%, identical to a sequence selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, more particularly 98% and even more particularly at least 99%, identical to a sequence selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 85%, particularly at least 90%, particularly at least 95%, more particularly a least 98% and even more particularly at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 90%, particularly at least 95%, more particularly a least 98% and even more particularly at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 95%, more particularly a least 98%, and even more particularly at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 98% and even more particularly at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 99% identical to a sequence selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 5 or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 6 or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 7 or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 8 or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 9 or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 10 or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 11 or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 12, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 15, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 16, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 17, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 18, or the complement thereof.
According to a particular embodiment, the nucleic acid comprises a nucleotide sequence at least 70%, particularly at least 75%, particularly at least 80%, particularly at least 85%, particularly at least 90%, particularly at least 95%, particularly at least 98%, and particularly at least 99%, identical to SEQ ID NO: 19, or the complement thereof.
The nucleic acid of an embodiment herein can be defined as including deoxyribonucleotide or ribonucleotide polymers in either single- or double-stranded form (DNA and/or RNA). The terms "nucleotide sequence" should also be understood as comprising a polynucleotide molecule or an oligonucleotide molecule in the form of a separate fragment or as a component of a larger nucleic acid. Nucleic acids of an embodiment herein also encompass certain isolated nucleotide sequences including those that are substantially free from contaminating endogenous material. The nucleic acid of an embodiment herein may be truncated, provided that it encodes a polypeptide encompassed herein, as described above.
In one embodiment, the nucleic acid of an embodiment herein can be either present naturally in a plant such as Juniperus viginiana, Platycladus orientalis `Beverleyensis`, or Platycladus orientalis, or other species, or be obtained by modifying SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19, or the complement thereof.
Mutations may be any kind of mutations of these nucleic acids, such as point mutations, deletion mutations, insertion mutations and/or frame shift mutations. A variant nucleic acid may be prepared in order to adapt its nucleotide sequence to a specific expression system. For example, bacterial expression systems are known to more efficiently express polypeptides if amino acids are encoded by particular codons.
Due to the degeneracy of the genetic code, more than one codon may encode the same amino acid sequence, multiple nucleic acid sequences can code for the same protein or polypeptide, all these DNA sequences being encompassed by an embodiment herein. Where appropriate, the nucleic acid sequences encoding the (+)-cedrol synthase and/or the (-)-thujopsene synthase may be optimized for increased expression in the host cell. For example, nucleotides of an embodiment herein may be synthesized using codons particular by a host for improved expression.
Another important tool for transforming host organisms or cells suitable to carry out the method of an embodiment herein in vivo is an expression vector comprising a nucleic acid according to any embodiment of an embodiment herein. Such a vector is therefore also provided herein.
The expression vectors provided herein may be used in the methods for preparing a genetically transformed host organism and/or cell, in host organisms and/or cells harboring the nucleic acids of an embodiment herein and in the methods for making polypeptides having a (+)-cedrol synthase activity and a (-)-thujopsene synthase activity, as disclosed further below.
Recombinant non-human host organisms and cells transformed to harbor at least one nucleic acid of an embodiment herein so that it heterologously expresses or over-expresses at least one polypeptide of an embodiment herein are also very useful tools to carry out the method of an embodiment herein. Such non-human host organisms and cells are therefore also provided herein.
A nucleic acid according to any of the above-described embodiments can be used to transform the non-human host organisms and cells and the expressed polypeptide can be any of the above-described polypeptides.
Non-human host organisms of an embodiment herein may be any non-human multicellular or unicellular organisms. In a particular embodiment, the non-human host organism is a plant, a prokaryote or a fungus. Any plant, prokaryote or fungus is suitable to be transformed according to the methods provided herein. Particularly useful plants are those that naturally produce high amounts of terpenes.
In a more particular embodiment the non-human host organism is a microorganism. Any microorganism is suitable to be used herein, but according to an even more particular embodiment said microorganism is a bacteria or yeast. Most particularly, said bacteria is E. coli and said yeast is Saccharomyces cerevisiae.
Isolated higher eukaryotic cells can also be transformed, instead of complete organisms. As higher eukaryotic cells, we mean here any non-human eukaryotic cell except yeast cells. Particular higher eukaryotic cells are plant cells or fungal cells.
A variant may also differ from the polypeptide of an embodiment herein by attachment of modifying groups which are covalently or non-covalently linked to the polypeptide backbone. The variant also includes a polypeptide which differs from the polypeptide described herein by introduced N-linked or O-linked glycosylation sites, and/or an addition of cysteine residues. The skilled artisan will recognize how to modify an amino acid sequence and preserve biological activity.
The functionality or activity of any (+)-cedrol synthase and/or a (-)-thujopsene synthase protein, variant or fragment, may be determined using various methods. For example, transient or stable overexpression in plant, bacterial or yeast cells can be used to test whether the protein has activity, i.e., produces (+)-cedrol and/or (-)-thujopsene from the FPP precursors. A (+)-cedrol synthase activity and/or a (-)-thujopsene synthase activity may be assessed in a microbial expression system, such as an assay described in the Examples provided herein.
An embodiment herein provides polypeptides of an embodiment herein to be used in a method to produce (+)-cedrol and/or a (-)-thujopsene by contacting an FPP precursor with the polypeptides of an embodiment herein either in vitro or in vivo.
Provided herein is also an isolated, recombinant or synthetic polynucleotide encoding a polypeptide or variant polypeptide provided herein.
Embodiments provided herein include, but are not limited to cDNA, genomic DNA and RNA sequences. Any nucleic acid sequence encoding the (+)-cedrol synthase and/or the (-)-thujopsene synthase or variants thereof is referred herein as a (+)-cedrol synthase and/or a (-)-thujopsene synthase encoding sequence.
It is clear to the person skilled in the art that genes, including the polynucleotides of an embodiment herein, can be cloned on basis of the available nucleotide sequence information, such as found in the attached sequence listing, by methods known in the art. These include e.g. the design of DNA primers representing the flanking sequences of such gene of which one is generated in sense orientations and which initiates synthesis of the sense strand and the other is created in reverse complementary fashion and generates the antisense strand. Thermostable DNA polymerases such as those used in polymerase chain reaction are commonly used to carry out such experiments. Alternatively, DNA sequences representing genes can be chemically synthesized and subsequently introduced in DNA vector molecules that can be multiplied by e.g. compatible bacteria such as e.g. E. coli.
Provided herein are nucleic acid sequences obtained by mutations of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19; such mutations can be routinely made. It is clear to the skilled artisan that mutations, deletions, insertions, and/or substitutions of one or more nucleotides can be introduced into these DNA sequence
To test a function of variant DNA sequences according to an embodiment herein, the sequence of interest is operably linked to a selectable or screenable marker gene and expression of the reporter gene is tested in transient expression assays with protoplasts or in stably transformed plants. The skilled artisan will recognize that DNA sequences capable of driving expression are built as modules. Accordingly, expression levels from shorter DNA fragments may be different than the one from the longest fragment and may be different from each other. Further provided herein are also functional equivalents of the nucleic acid sequence coding the (+)-cedrol synthase and/or the (-)-thujopsene synthase proteins, i.e., nucleotide sequences that hybridize under stringent conditions to the nucleic acid sequence of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 or SEQ ID NO: 19.
The skilled artisan will be aware of methods to identify homologous sequences in other organisms and methods (identified in the Definition section herein) to determine the percentage of sequence identity between homologous sequences.
An alternative embodiment provided herein provides a method to alter gene expression in a host cell. For instance, the polynucleotide of an embodiment herein may be enhanced or overexpressed or induced in certain contexts (e.g. following insect bites or stings or upon exposure to a certain temperature) in a host cell or host organism.
Alteration of expression of a polynucleotide provided herein also results in "ectopic expression" which is a different expression pattern in an altered and in a control or wild-type organism. Alteration of expression occurs from interactions of polypeptide of an embodiment herein with exogenous or endogenous modulators, or as a result of chemical modification of the polypeptide. The term also refers to an altered expression pattern of the polynucleotide of an embodiment herein which is altered below the detection level or completely suppressed activity.
In one embodiment, several (+)-cedrol synthase and/or a (-)-thujopsene synthase encoding nucleic acid sequences are co-expressed in a single host, particularly under control of different promoters. Alternatively, several (+)-cedrol synthases and/or (-)-thujopsene synthases protein encoding nucleic acid sequences can be present on a single transformation vector or be co-transformed at the same time using separate vectors and selecting transformants comprising both chimeric genes.
The nucleic acid sequences of an embodiment herein encoding (+)-cedrol synthase and/or (-)-thujopsene synthase proteins can be inserted in expression vectors and/or be contained in chimeric genes inserted in expression vectors, to produce (+)-cedrol synthase and/or a (-)-thujopsene synthase proteins in a host cell or host organism. The vectors for inserting transgenes into the genome of host cells are well known in the art and include plasmids, viruses, cosmids and artificial chromosomes. Binary or co-integration vectors into which a chimeric gene is inserted are also used for transforming host cells.
An embodiment provided herein provides recombinant expression vectors comprising a nucleic acid encoding for a (+)-cedrol synthase and/or a (-)-thujopsene synthase, or a chimeric gene comprising a nucleic acid sequence encoding for a (+)-cedrol synthase and/or a (-)-thujopsene synthase, operably linked to associated nucleic acid sequences such as, for instance, promoter sequences.
Alternatively, the promoter sequence may already be present in a vector so that the nucleic acid sequence which is to be transcribed is inserted into the vector downstream of the promoter sequence. Vectors are typically engineered to have an origin of replication, a multiple cloning site, and a selectable marker.
In one aspect, (+)-cedrol and (-)-thujopsene may be purified from synthase products.
The (+)-cedrol and (-)-thujopsene produced by any of the methods described herein can be converted to derivatives such as, but not limited to hydrocarbons, esters, amides, glycosides, ethers, epoxides, aldehydes, ketons, alcohols, diols, acetals or ketals.
The (+)-cedrol and (-)-thujopsene derivatives can be obtained by a chemical method such as, but not limited to oxidation, reduction, alkylation, acylation, deshydration and/or rearrangement. Examples of chemical conversion of (+)-cedrol and (-)-thujopsene can be found in Charles S. Cell. A Fragrant Introduction to Terpenoid Chemistry. The royal Society of chemistry, 2003. Page 163-172; G. Ohloff, W. Pickenhagen, P. Kraft. Scent and Chemistry--The Molecular World of Odors, Verlag Helvetica Chimica Acta, Zurich, 2011, page 172-174; US007615525; US 20120077722; U.S. Pat. No. 3,845,132 or WO2005083045.
Alternatively, the (+)-cedrol and (-)-thujopsene derivatives can be obtained using a biochemical method by contacting the (+)-cedrol or (-)-thujopsene with an enzyme such as, but not limited to an oxidoreductase, a monooxygenase, a dioxygenase, a transferase. The biochemical conversion can be performed in-vitro using isolated enzymes or in-vivo using whole cells. For example, the same host organisms or cells which produce the (+)-cedrol and (-)-thujopsene can be engineered to express enzymes which are needed to produce derivatives. Examples of biochemical conversion of (+)-cedrol and (-)-thujopsene can be found in Abraham, W. R., P. Washausen, and K. Kieslich. 1987. Z. Naturforsch. 42c, 414-419; Takigawa H., Kubota H., Sonohara H., Okuda M., Tanaka S., Fujikura Y. and Ito S. Novel. 1993, Environ Microbiol. 59(5), 1336-1341; Lamare, V., J. D. Fourneron, and R. Furstoss. 1987, Tetrahedron Lett. 28, 6269-6272; Lamare, V., and R. Furstoss. 1990, Tetrahedron 46. 4109-132; Sakamaki H1, Kitanaka S, Chai W, Hayashida Y, Takagi Y, Horiuchi C A. 2001. J. Nat. Prod. 64(5). 630-631.
Further provided herein are (+)-cedrol derivatives selected from the compounds set forth in Table I.
TABLE-US-00001 TABLE 1 (Examples of cedrol derivatives) ##STR00001## ##STR00002## ##STR00003## ##STR00004## ##STR00005## ##STR00006## ##STR00007## ##STR00008## ##STR00009## ##STR00010## ##STR00011## ##STR00012##
Further provided herein are (-)-thujopsene derivatives selected from the compounds set forth in Table 2.
TABLE-US-00002 TABLE 2 (Examples of thujopsene derivates) ##STR00013## ##STR00014## ##STR00015## ##STR00016## ##STR00017## ##STR00018## ##STR00019## ##STR00020## ##STR00021## ##STR00022## ##STR00023## ##STR00024## ##STR00025##
Also provided herein are products comprising (+)-cedrol and (-)-thujopsene or derivatives thereof produced according to the methods described herein.
The following examples are illustrative only and are not intended to limit the scope of the claims or embodiments provided herein.
Example 1
Juniperus virginiana Plant Material and Root Transcriptome Sequencing
Seeds of Juniperus virginiana were obtained from B&T World SEEDS (Aigues-Vives, France). Seeds were germinated directly in soil in 0.5 L pots. One to two-year old plants were collected for the analysis of the composition in metabolites and transcriptome analysis. The plants were removed from the pots and the roots rinsed with tap water.
The areal part and the roots were separated and frozen in liquid nitrogen. The tissues were first roughly chopped in liquid nitrogen using a Waring Blender (Waring Laboratory, Torrington, USA) and then ground to a fine powder using a mortar and pestle. Samples of the aerial and underground part were extracted with an excess of MTBE (Methyl tert-butyl ether) and analyzed by GCMS. The analysis was performed on an Agilent 6890 Series GC system connected to an Agilent 5975 mass detector. The GC was equipped with 0.25 mm inner diameter by 30 m DB-1 ms capillary column (Agilent). The carrier gas was He at a constant flow of 1 mL/min. The initial oven temperature was 50.degree. C. (1 min hold) followed by a gradient of 10.degree. C./min to 300.degree. C. The identification of the products was based on the comparison of the mass spectra and retention indices with authentic standards and internal databases. The analysis showed that cedrol was present only in the roots and not in the aerial part (FIG. 1).
The roots of the J. virginiana plants were thus taken for the transcriptome analysis. Total RNA was extracted following the procedure described in Kolosova et al (Kolosova N, Miller B, Ralph S, Ellis B E, Douglas C, Ritland K, and Bohlmann J, Isolation of high-quality RNA from gymnosperm and angiosperm trees. J. Biotechniques, 36(5), 821-4, 2004) with the following modifications. A volume of 10 ml of extraction buffer was used for 1 grams of ground tissue and the extraction buffer was supplemented with 2% (w/v) of PVP (polyvinylpyrrolidone, Sigma-Aldrich). For the CTAB (cethyltrimethylammonium bromide, Sigma-Aldrich) extraction, the nucleic acid pellet was resuspended in 2 ml TE buffer (10 mM Tris-HCl, pH 8, 1 mM EDTA) and the extraction was performed with 2 ml of 5M NaCl and 1 ml 10% CTAB. For the isopropanol precipitation, the nucleic acid pellet was dissolved in 500 .mu.l TE. The final RNA pellet was resuspended in sterile distilled water.
The root transcriptome was sequenced using the Illumina Total RNA-Seq technique and the Illumina HiSeq 2000 sequencer. A total of 16.2 millions of paired-reads of 2.times.100 bp were generated. The reads were assembled using the Velvet de novo genomic assembler (http://www.ebi.ac.uk/.about.zerbino/velvet/) and the Oases software (http://www.ebi.ac.uk/.about.zerbino/oases/). A total 46,644 contigs with an average size of 1,241 bp were assembled. The contigs were search using the tBlastn algorithm (Altschul et al, J. Mol. Biol. 215, 403-410, 1990) and using as query the amino acid sequences of known sesquiterpene synthases. This approach allowed the detection of 138 different terpene synthases encoding sequences. After further sorting of the data, 17 full-length sequences were retained based on their amino-acid sequence homology with known sesquiterpene synthases.
Example 2
Functional Expression of J. virginiana Sesquiterpene Synthases
Codon optimized versions of the selected putative terpene-encoding sequences were synthesized in-vitro and cloned in the pJ411 expression plasmid (DNA2.0, Menlo Park, Calif., USA). Heterologous expression of the J. virginiana terpene synthases was performed in KRX E. coli cells (Promega). Single colonies of transformed cells were used to inoculate 5 ml LB medium. After 5 to 6 hours incubation at 37.degree. C., the cultures were transferred to a 20.degree. C. incubator and left 1 hour for equilibration. Expression of the protein was then induced by the addition of 1 mM IPTG and 0.2% rhamnose and the culture was incubated over-night at 20.degree. C. The next day, the cells were collected by centrifugation, resuspended in 0.1 volume of 50 mM MOPSO pH 7, 10% glycerol and lyzed by sonication. The extracts were cleared by centrifugation (30 min at 20,000 g) and the supernatants containing the soluble proteins were used for further experiments.
The crude E. coli protein extracts containing the recombinant protein were used for the characterization of the enzymatic activities. The assays were performed in 2 mL of 50 mM MOPSO pH 7, 10% glycerol, 1 mM DTT, 10 mM MgCl.sub.2 in the presence of 10 to 100 .mu.M of farnesyl-diphosphate (FPP, Sigma) and 0.1 to 0.5 mg of crude protein. The tubes were incubated 12 to 24 hours at 30.degree. C. and extracted twice with one volume of pentane. After concentration under a nitrogen flux, the extracts were analysed by GC and GC-MS and compared to extracts from assays with control proteins. The analysis of the products formed by the enzymes was made by GCMS as described in example 1. In these conditions, four recombinant terpene synthases produce cedrol in addition to several other sesquiterpene products. Thus, JvCP1206-3, JvCP1206-4 and JvCP1206-6 produces a mixture of sequiterpene of which cedrol represents at least 70 to 80% of the total sesquiterpene compounds produced. The JvCP1206-5 enzyme produced a mixture in which (-)-thujopsene was the major product and cedrol represented 10% of the total sesquiterpene compounds (FIG. 2).
Example 3
Use of the Recombinant J. virginiana Sesquiterpene Synthase for In-Vivo Production of (+)-Cedrol and (-)-Thujopsene in Engineered Cells
To evaluate the in-vivo production of cedrol and thujopsene in heterologous cells, E. coli cells were transformed with the pJ411 (pJ411-JvCP1206-4, pJ411-JvCP1206-3, pJ411-JvCP1206-6 and pJ411-JvCP1206-5) plasmids containing one of the four J. virginiana sesquiterpene synthase identified in Example 2 and the production of sesquiterpenes from the endogenous FPP pool was evaluated. To increase the productivity of the cells, an heterologous FPP synthase and an the enzymes from a complete heterologous mevalonate (MVA) pathway were also expressed in the same cells. The construction of the expression plasmid containing an FPP synthase gene and the gene for a complete MVA pathway was described in patent WO2013064411 or in Schalk et al (2013) J. Am. Chem. Soc. 134, 18900-18903. Briefly, an expression plasmid was prepared containing two operons composed of the genes encoding the enzymes for a complete mevalonate pathway. A first synthetic operon consisting of an E. coli acetoacetyl-CoA thiolase (atoB), a Staphylococcus aureus HMG-CoA synthase (mvaS), a Staphylococcus aureus HMG-CoA reductase (mvaA) and a Saccharomyces cerevisiae FPP synthase (ERG20) genes was synthetized in-vitro (DNA2.0, Menlo Park, Calif., USA) and ligated into the NcoI-BamHI digested pACYCDuet-1 vector (Invitrogen) yielding pACYC-29258. A second operon containing a mevalonate kinase (MvaK1), a phosphomevalonate kinase (MvaK2), a mevalonate diphosphate decarboxylase (MvaD), and an isopentenyl diphosphate isomerase (idi) was amplified from genomic DNA of Streptococcus pneumoniae (ATCC BAA-334) and ligated into the second multicloning site of pACYC-29258 providing the plasmid pACYC-29258-4506. This plasmid thus contains the genes encoding all enzymes of the biosynthetic pathway leading from acetyl-coenzyme A to FPP.
KRX E. coli cells (Promega) were co-transformed with the plasmid pACYC-29258-4506 and either the plasmid pJ411-JvCP1206-4, pJ411-JvCP1206-3, pJ411-JvCP1206-6 or pJ411-JvCP1206-5. Transformed cells were selected on carbenicillin (50 .mu.g/ml) and chloramphenicol (34 .mu.g/ml) LB-agarose plates. Single colonies were used to inoculate 5 mL liquid LB medium supplemented with the same antibiotics. The culture was incubated overnight at 37.degree. C. The next day 2 mL of TB medium supplemented with the same antibiotics were inoculated with 0.2 mL of the overnight culture. After 6 hours incubation at 37.degree. C., the culture was cooled down to 28.degree. C. and 0.1 mM IPTG and 0.2% rhamnose were added to each tube. The cultures were incubated for 48 hours at 28.degree. C. The cultures were then extracted twice with 2 volumes of MTBE, the organic phase were concentrated to 500 .mu.L and analyzed by GC-MS as described above in Example 1.
In this in-vivo conditions the four sesquiterpene synthases produced mixtures of sesquiterpene with the same ratio of (+)-cedrol as in the in-vitro assays: 70 to 80% of (+)-cedrol for JvCP1206-3, JvCP1206-4 and JvCP1206-6 and 10% for JvCP1206-5 (FIG. 3). With JvCP1206-5, (-)-thujopsene was the major product in the mixture of sesquiterpene produced.
Using these engineered E. coli cells, larger (1 L) cultures were used to produce larger quantities of the sequiterpene product mixture produced by these enzymes. The (+)-cedrol was purified from the product mixture by flash chromatography on a silica gel column. A sufficient quantity was obtained to confirm the structure by NMR analysis. The optical rotation was measured using a Bruker Avance 500 MHz spectrometer. The value of [.alpha.].sup.D.sub.20=+10.6.degree. (0.85%, CHCl.sub.3) was in accordance with the literature and confirmed the production of (+)-cedrol.
Example 4
Sequence Comparison of the Four J. virginiana Cedrol Synthases
The amino acid sequences of the four J. virginiana cedrol synthases were aligned using the ClustalW program and the sequence identities were deduced from the alignment.
The sequence identities between the four cedrol synthases are shown in the table below.
TABLE-US-00003 JvCP1206-3 JvCP1206-4 JvCP1206-6 JvCP1206-5 JvCP1206-3 ID 97 98.6 93.4 JvCP1206-4 97 ID 98.4 92.2 JvCP1206-6 98.6 98.4 ID 93.7 JvCP1206-5 92.4 92.2 93.7 ID
Example 5
Cedarwood Plant Material Sourcing and Leaf Transcriptome Sequencing
Platycladus orientalis `Beverleyensis` and Platycladus orientalis plant materials were collected from Hangzhou, Zhejiang Province, China. To establish whether P. orientalis `Beverleyensis` (sample ID: PNLI20141232) and P. orientalis (sample ID: PNLI20141243) contained (+)-cedrol and (-)-thujopsene, their fresh leaves were extracted with dichloromethane for chemical analysis respectively. The extracts were analysed by GC/MS, the parameters of GC/MS analysis were described as below: An Agilent 6890 series GC system equipped with a DB1-ms column 30 m.times.0.25 mm.times.0.25 m film thickness (P/N 122-0132, J&W scientific Inc., Folsom, Calif.) and coupled with a 5975 series mass spectrometer was used. The carrier gas was helium at a constant flow of 0.7 mL/min. Injection was in split (1:25) mode with the injector temperature set at 250.degree. C. The oven temperature was programmed from 50.degree. C. (5 min hold) to 300.degree. C. at 5.degree. C./min, then to 340.degree. C. at 50.degree. C./min and held for 3 min. Identification of products was based on mass spectra and retention indices. GC/MS analysis revealed that leaves of P. orientalis `Beverleyensis` contained 37% (+)-cedrol in its total volatile sesquiterpene (FIGS. 5 and 6), whereas the leaves of P. orientalis contained 11% (-)-thujopsene in its total volatile sesquiterpene (FIGS. 7 and 8).
Fresh leaves of P. orientalis `Beverleyensis` and P. orientalis were used for transcriptome analysis. Total RNA was extracted using the RNeasy Plant Mini Kit (Qiagen, Germany). These total RNA samples were processed using the NEBNext.RTM. Ultra.TM. RNA Library Prep Kit for Illumina (NEB, USA) and TruSeq PE Cluster Kit (Illumina, USA) and then sequenced on Illumina Hiseq 2500 sequencer. An amount of 17 and 22.6 millions of paired-end reads of 2.times.150 bp was generated for P. orientalis `Beverleyensis` and P. orientalis, respectively. The reads from P. orientalis `Beverleyensis` and P. orientalis were respectively assembled using the Trinity (http://trinityrnaseq.sf.net/) software. 58300 unigenes with an N50 of 1564 bp and 62252 unigenes with an N50 of 1602 bp were obtained from P. orientalis `Beverleyensis` and P. orientalis, respectively. The unigenes were annotated by the InterProScan software (http://www.ebi.ac.uk/Tools/pfa/iprscan/). The sequences of (+)-cedrol synthases and (-)-thujopsene synthase from prior art were used for searching the potential (+)-cedrol synthase and (-)-thujopsene synthase from P. orientalis `Beverleyensis` and P. orientalis. This approach provided 2 new putative sesquiterpene synthases sequences for each of the species, including PorB1 from P. orientalis `Beverleyensis` and Por2-3-5 from P. orientalis. The enzymatic activity of PorB1 and Por2-3-5 was evaluated as described in Example 6.
Example 6
Functional Expression and Characterization of PorB1 and Por2-3-5
The total RNA extracted by RNeasy Plant Mini Kit (Qiagen, Germany) was first reverse transcribed into cDNA using SMARTer.TM. RACE cDNA Amplification Kit (Clontech), and then the product was used as the template for gene cloning. PorB1 was amplified from the cDNA of P. orientalis `Beverleyensis` by using forward primer (5'-TTTAAGTGCTTCTGCGATG-3' (SEQ ID NO: 20)) and reverse primer (5'-ACATCTAGGTTTGTGCCTT-3' (SEQ ID NO: 21)). Por2-3-5 was considered to be improperly assembled so a gene specific reverse primer (5'-ATCGCCATCTCCAGTGTG-3' (SEQ ID NO: 22)) together with the Universal Primer A Mix provided by SMARTer.TM. RACE cDNA Amplification Kit (Clontech) were used to clone the 5' end sequence of Por2-3-5, from which the forward primer for full length cloning was designed. Por2-3-5 was then amplified from the cDNA of P. orientalis by using forward primer (5'-CTTTAGTGCTTCTGTGATG-3' (SEQ ID NO: 23)) and reverse primer (5'-CATACAAGTTTGTGCCTCA-3' (SEQ ID NO: 24)). The sequences of PorB1 and Por2-3-5 were optimized by following the genetic codon frequency of E. coli and synthesized. The restriction site of NdeI was added to the 5' end of both PorB1 and Por2-3-5 while KpnI was added to the 3' end. PorB1 and Por2-3-5 were subcloned either into the pJ401 (DNA 2.0) plasmid or into the pETDuet-1 (Novagen) plasmid for subsequent expression in E. coli.
KRX E. coli cells (Promega) were co-transformed with the plasmid pACYC/ScMVA (containing the genes encoding for a heterologous mevalonate pathway, and the plasmid pJ401-PorB1, pETDuet-PorB1, pJ401-Por2-3-5 and pETDuet-Por2-3-5, respectively. To construct the pACYC/ScMVA plasmid, we divided the eight biosynthetic genes into 2 synthetic operons referred as the `upper` and `lower` mevalonate (MVA) pathway. As an upper MVA pathway, we created a synthetic operon consisting of an acetoacetyl-CoA thiolase from E. coli encoded by atoB, a HMG-CoA synthase and a truncated version of HMG-CoA reductase from Saccharomyces cerevisiae encoded by ERG13 and ERG19, respectively. This operon transforms the primary metabolite Acetyl-CoA into (R)-mevalonate. As a `lower` mevalonate pathway, we created a second synthetic operon encoding a mevalonate kinase (ERG12, S. cerevisiae), a phosphomevalonate kinase (ERG8, S. cerevisiae), a phosphomevalonate decarboxylase (MVD1, S. cerevisiae), an isopentenyl diphosphate isomerase (idi, E. coli) and a farnesyl pyrophosphate (FPP) synthase (IspA, E. coli). Finally, a second FPP synthase from S. cerevisiae (ERG20) was introduced into the upper pathway operon to improve the conversion of the isoprenoid C5 units (IPP and DMAPP) into farnesyl pyrophosphate (FPP). Each operon was subcloned into one of the multiple-cloning sites of a low-copy expression plasmid under the control of a bacteriophage T7 promoter (pACYCDuet-1, Invitrogen).
The co-transformed cells were selected on LB-agar plates containing kanamycin (50 .mu.g/mL final) and chloramphenicol (34 .mu.g/mL final). Single colonies were used to inoculate 5 mL liquid LB medium supplemented with the same antibiotics and glucose (0.4% w/v final), overlayed with 500 .mu.l of decane. Cultures were incubated overnight at 37.degree. C. and 200 rpm shaking. The next day 2 mL of TB medium supplemented with the same antibiotics and glycerol (6% w/v final) were inoculated with 0.3 mL of the overnight cultures, overlayed with 200 .mu.l of decane. After 6 hours of incubation at 37.degree. C. and shaking at 200 rpm, the cultures were cooled down to 25.degree. C. for an hour and IPTG (0.1 M final) and rhamnose (0.02% w/v final) were added to each tube. The cultures were incubated for another 48 hours at 25.degree. C. and 180 rpm shaking. The cultures were then extracted with 1 volume of MTBE, and 50 .mu.l of isolongifolene at 2 mg/mL was added as internal standard before analysing the samples by GC/MS. GC/MS analysis used the same system as described in Example 5. The carrier gas was helium at a constant flow of 1.0 mL/min. Injection was in splitless mode with the injector temperature set at 250.degree. C. The oven temperature was programmed from 80.degree. C. to 220.degree. C. at 10.degree. C./min, then to 280.degree. C. at 30.degree. C./min and held for 1 min. Identification of products was based on mass spectra and retention indices. GC/MS analysis revealed that PorB1 produced (+)-cedrol as the main product with a selectivity of 78% to 88% (FIGS. 9 and 10) and that Por2-3-5 produced (-)-thujopsene as the main product with a selectivity of 45% to 55% (FIGS. 11 and 12).
Example 7
Sequence Comparison of the Cedrol Synthases
The amino acid sequences of PorB1 and Por2-3-5 and of the four J. virginiana cedrol synthases were aligned using the ClustalW program and the sequence identities were deduced from the alignment. The sequence identities between the synthases are shown in the table below.
TABLE-US-00004 Query sequence PorB1 Por2-3-5 JvCP1206-3 JvCP1206-4 JvCP1206-5 JvCP1206-6 PorB1 ID 74.10 76.16 76.33 77.36 76.16 Por2-3-5 74.27 ID 76.59 76.42 79.17 76.25
TABLE-US-00005 -Sequence listing- SEQ ID NO: 1 JvCP1206-4, amino acid sequence. MSNLKGDHISSVSSIPAHAFNEWGDAFVQSMEMPYGEPEYRERAETLVKQ VKILLKEMQTGDGDLIERLEMVDALQCLGIERYFQAEIKEALDYVYRSWD GTVGIGLGCNSATKHLNATALGLRVLRLHRYDVSPDTLYNFKDNTGEFVL CGENKVSNDEDTNKEEKVMRSMLNLLRLSSLAFPGEIIMEEAQAFSTRYL KELLEISGDTFNRSFIKEVEYALTYEWPRTFTRWEAWNFIEICDLDNDRL EDKRILQLAKLDFNILQFQYKLEMKNLSSWWVESGISNLVATRARHIEYL FWAVASTDEMEFSSSRIALAKTTAIITVMDDIFDDYATLEYLKCISDAIS KNWDVSIIENIPNNLKTCFEFISKTVHQMAIDATKYQGRDMMPFITKAWA DYIEACFEEARWKLTGYFPTYDEYMKSAELCVGFGQIFLSSGLLASPNLC DDDIEKIYLDKSRFFKLMRVCMRLIDDINDFEDERLHGKIASAIACYKGD HPNCSESEAINQIITLNNKLLRELTREFFKSNMNFLEWQKICVNSTRGVQ FFYIFRDGFTYSHKEIKQQIFKILVDPIKM SEQ ID NO: 2 JvCP1206-3, amino acid sequence. MSNLKGDHISSVSSIPAHAFNEWGDAFVQSMEMPYGEPEYRERAETLVKQ VKILLKEMQTGDGDLIERLEMVDALQCLGIERYFQAEIKEALDYVYRSWD GTVGIGLGCNSATKHLNATALGLRVLRLHRYDVSPDTLHNFKDNTGKFVL TGENKDNNDEDTNKEEKVMRSILNLFRLSSLAFPGEIIMEEAKAFSTRYL KELLEISRDTFNRSFIKEVEYALTYEWPRTFTRWEAWNFIEICDLDNDRL EDKRILQLAKLDFNILQFQYKLEMKNLSSWWVESGISNLVATRARHIEYL FWAVASTDEMEFSSSRIALAKTTAIITVMDDIFDDYATLEYLKCISDAIS KNWDVSIIENIPNNLKTCFEFISKTVHQMAIDATKYQGRDMMPFITKAWA DYIEACFEEARWKLTGYFPTYDEYMKSAELCVGFGQIFLSSGLLASPNLC DDDIEKIYLDKSRFFKLMRVCMRLIDDINDFEDERLHGKIASAIACYKGD HPNCSESEAINQIVMLNNKLLRELTREFLKSNMNFLEWEKICVNSTRGVQ FCYIFGDGFTYSHKEIKQQIFKILVNPIKV SEQ ID NO: 3 JvCP1206-6, amino acid sequence. MSNLKGDHISSVSSIPAHAFNEWGDAFVQSMEMPYGEPEYRERAETLVKQ VKILLKEMQTGDGDLIERLEMVDALQCLGIERYFQAEIKEALDYVYRSWD GTVGIGLGCNSATKHLNATALGLRVLRLHRYDVSPDTLHNFKDNTGKFVL TGENKDNNDEDTNKEEKVMRSILNLFRLSSLAFPGEIIMEEAKAFSTRYL KELLEISRDTFNRSFIKEVEYALTYEWPRTFTRWEAWNFIEICDLDNDRL EDKRILQLAKLDFNILQFQYKLEMKNLSSWWVESGISNLVATRARHIEYL FWAVASTDEMEFSSSRIALAKTTAIITVMDDIFDDYATLEYLKCISDAIS KNWDVSIIENIPNNLKTCFEFISKTVHQMAIDATKYQGRDMMPFITKAWA DYIEACFEEARWKLTGYFPTYDEYMKSAELCVGFGQIFLSSGLLASPNLC DDDIEKIYLDKSRFFKLMRVCMRLIDDINDFEDERLHGKIASAIACYKGD HPNCSESEAINQIITLNNKLLRELTREFFKSNMNFLEWQKICVNSTRGVQ FFYIFRDGFTYSHKEIKQQIFKILVDPIKM SEQ ID NO: 4 JvCP1206-5, amino acid sequence. MSNLKGDHISSVSSIPAHAFNEWGDAFVQSMEMPYGEPEYRERAETLVKQ VKILLKEMQTGDGDLIERLEMVDALQCLGIERYFQAEIKEALDYVYRSWD GTVGIGLGCNSATKHLNATALGLRVLRLHRYDVSPDTLHNFKDNTGKFVL TGENKDNNDEDTNKEEKVMRSILNLFRLSSLAFPGEIIMEEAKAFSTRYL KELLEISRDTFNRSFIKEVEYALTYEWPRTFTRWEARNFIEICDLDNDRL KDKRILELAKLDFNILQFQYQLEMKNLSRWWVESGISNLVATRERSIEYL FWAVTSTDELEFSSSRIAHAKCTTIITIMDDIFDDYATLEQLKCIVDAIS KNWDVSIIENIPNNLKTCFEFVSKTVHELAIDATEYQGRDMMPFITKAWT DYGEACFEQACWKVKGYFPTYNEYIKCAELSVAFGPILLHTALLASPDLC DDDIEKIYLDKSRFFKLMRVCMRLIDDINDFEDERLHGKIASAIACYKGD HPNCSESEAINQIITLNNKLLRELTREFFKSNMNFLEWQKICVNSTRGVQ FFYIFRDGFTYSHKEIKQQIFKILVDPIKM SEQ ID NO: 5 JvCP1206-4, wild type cDNA sequence. ATGTCGAATTTGAAAGGAGACCACATTTCTTCTGTTTCTTCCATTCCAGC CCATGCTTTTAATGAGTGGGGCGATGCTTTTGTTCAATCTATGGAGATGC CGTACGGGGAACCTGAATACCGTGAACGTGCTGAAACACTTGTGAAACAA GTCAAAATCTTGTTAAAAGAAATGCAAACTGGAGATGGTGATCTAATCGA GCGGCTTGAGATGGTTGATGCTTTGCAATGCCTTGGCATTGAGCGATATT TTCAGGCTGAGATTAAAGAAGCTCTTGATTACGTTTACCGCTCTTGGGAT GGAACTGTGGGAATAGGATTAGGCTGCAACAGTGCTACAAAGCATTTGAA TGCCACAGCTTTGGGACTCAGAGTACTTCGACTCCATCGTTATGACGTCT CTCCAGACACGTTGTACAATTTCAAGGACAATACTGGCGAGTTCGTCCTC TGTGGAGAAAATAAAGTGAGTAACGATGAGGATACTAATAAGGAAGAGAA AGTGATGAGAAGTATGCTCAACCTGTTAAGACTATCCAGTTTGGCATTCC CTGGAGAAATCATTATGGAAGAGGCTCAAGCATTTAGCACTAGATATCTT AAAGAATTATTAGAAATTTCTGGAGATACATTTAACAGGAGTTTTATTAA AGAGGTGGAGTATGCTCTTACATATGAATGGCCTCGAACCTTTACTAGAT GGGAGGCGTGGAATTTCATAGAGATCTGTGATTTAGATAATGACAGGTTG GAAGACAAAAGGATTTTACAGCTTGCAAAATTGGATTTTAATATACTACA ATTTCAATATAAGTTGGAGATGAAAAATCTGTCAAGTTGGTGGGTTGAAT CTGGCATCTCCAATCTGGTTGCAACAAGGGCCCGACATATTGAATATCTT TTTTGGGCAGTTGCTTCTACAGATGAGATGGAGTTTTCTAGTAGTAGAAT AGCTCTTGCAAAGACCACCGCAATTATTACAGTAATGGATGACATTTTTG ATGACTATGCAACACTTGAGTATCTCAAATGTATTTCAGATGCCATTTCT AAAAATTGGGATGTTTCTATTATAGAAAATATTCCCAACAACTTGAAGAC ATGTTTTGAATTTATTTCTAAAACAGTTCATCAAATGGCAATAGATGCTA CTAAATATCAAGGACGTGACATGATGCCTTTTATTACAAAAGCGTGGGCA GATTATATAGAAGCCTGCTTTGAGGAGGCACGCTGGAAACTGACAGGATA TTTTCCAACCTACGATGAGTACATGAAATCTGCTGAACTATGTGTTGGAT TTGGACAGATATTTTTATCTAGTGGGCTACTAGCATCTCCTAATTTATGT GATGATGATATTGAGAAGATATACCTTGACAAATCTAGATTCTTTAAACT CATGCGAGTGTGTATGCGGTTGATTGATGATATAAATGATTTTGAGGATG AGAGGCTCCATGGAAAGATTGCCTCAGCTATTGCTTGTTACAAGGGTGAT CATCCAAATTGTTCAGAAAGCGAGGCCATCAATCAAATCATCACGCTCAA TAATAAATTATTGAGAGAATTGACAAGAGAATTTTTTAAATCAAATATGA ATTTTCTTGAATGGCAAAAGATATGTGTCAATAGTACCAGAGGAGTACAA TTTTTCTATATATTTAGAGATGGGTTTACATATTCTCACAAGGAGATCAA GCAGCAGATATTTAAAATCCTTGTTGATCCAATAAAAATGTAG SEQ ID NO: 6 JvCP1206-3, wild type cDNA sequence. ATGTCGAATTTGAAAGGAGACCACATTTCTTCTGTTTCTTCCATTCCAGC CCATGCTTTTAATGAGTGGGGCGATGCTTTTGTTCAATCTATGGAGATGC CGTACGGGGAACCTGAATACCGTGAACGTGCTGAAACACTTGTGAAACAA GTCAAAATCTTGTTAAAAGAAATGCAAACTGGAGATGGTGATCTAATCGA GCGGCTTGAGATGGTTGATGCTTTGCAATGCCTTGGCATTGAGCGATATT TTCAGGCTGAGATTAAAGAAGCTCTTGATTACGTTTACCGCTCTTGGGAT GGAACTGTGGGAATAGGATTAGGCTGCAACAGTGCTACAAAGCATTTGAA TGCCACAGCTTTGGGACTCAGAGTACTTCGACTCCATCGTTATGACGTCT CTCCAGACACGTTGCACAATTTCAAGGACAATACTGGGAAGTTCGTCCTC ACTGGAGAAAATAAAGACAATAACGATGAAGATACTAATAAGGAAGAGAA AGTGATGAGAAGTATTCTCAACCTGTTCAGACTATCCAGTTTGGCATTCC CTGGAGAAATTATTATGGAAGAGGCTAAAGCATTTAGCACTAGATATCTT AAAGAATTATTAGAAATTTCTAGAGATACATTTAACAGGAGTTTTATTAA AGAGGTGGAGTATGCTCTTACATATGAATGGCCTCGAACCTTTACTAGAT GGGAGGCGTGGAATTTCATAGAGATCTGTGATTTAGATAATGACAGGTTG GAAGACAAAAGGATTTTACAGCTTGCAAAATTGGATTTTAATATACTACA ATTTCAATATAAGTTGGAGATGAAAAATCTGTCAAGTTGGTGGGTTGAAT CTGGCATCTCCAATCTGGTTGCAACAAGGGCCCGACATATTGAATATCTT TTTTGGGCAGTTGCTTCTACAGATGAGATGGAGTTTTCTAGTAGTAGAAT AGCTCTTGCAAAGACCACCGCAATTATTACAGTAATGGATGACATTTTTG ATGACTATGCAACACTTGAGTATCTCAAATGTATTTCAGATGCCATTTCT AAAAATTGGGATGTTTCTATTATAGAAAATATTCCCAACAACTTGAAGAC ATGTTTTGAATTTATTTCTAAAACAGTTCATCAAATGGCAATAGATGCTA CTAAATATCAAGGACGTGACATGATGCCTTTTATTACAAAAGCGTGGGCA GATTATATAGAAGCCTGCTTTGAGGAGGCACGCTGGAAACTGACAGGATA TTTTCCAACCTACGATGAGTACATGAAATCTGCTGAACTATGTGTTGGAT TTGGACAGATATTTTTATCTAGTGGGCTACTAGCATCTCCTAATTTATGT GATGATGATATTGAGAAGATATACCTTGACAAATCTAGATTCTTTAAACT CATGCGAGTGTGTATGCGGTTGATTGATGATATAAATGATTTTGAGGATG AGAGGCTCCATGGAAAGATTGCCTCAGCTATTGCTTGTTACAAGGGTGAT CATCCAAATTGTTCAGAAAGTGAGGCCATCAATCAAATCGTCATGCTCAA TAATAAATTATTGAGAGAATTGACAAGAGAATTTTTAAAATCAAATATGA ATTTTCTTGAATGGGAAAAGATATGTGTCAATAGTACAAGAGGGGTACAA TTTTGCTATATATTTGGAGATGGGTTTACATATTCTCACAAGGAGATCAA GCAACAGATATTTAAAATTCTTGTCAATCCAATAAAAGTGTAG SEQ ID NO: 7
JvCP1206-6, wild type cDNA sequence. ATGTCGAATTTGAAAGGAGACCACATTTCTTCTGTTTCTTCCATTCCAGC CCATGCTTTTAATGAGTGGGGCGATGCTTTTGTTCAATCTATGGAGATGC CGTACGGGGAACCTGAATACCGTGAACGTGCTGAAACACTTGTGAAACAA GTCAAAATCTTGTTAAAAGAAATGCAAACTGGAGATGGTGATCTAATCGA GCGGCTTGAGATGGTTGATGCTTTGCAATGCCTTGGCATTGAGCGATATT TTCAGGCTGAGATTAAAGAAGCTCTTGATTACGTTTACCGCTCTTGGGAT GGAACTGTGGGAATAGGATTAGGCTGCAACAGTGCTACAAAGCATTTGAA TGCCACAGCTTTGGGACTCAGAGTACTTCGACTCCATCGTTATGACGTCT CTCCAGACACGTTGCACAATTTCAAGGACAATACTGGGAAGTTCGTCCTC ACTGGAGAAAATAAAGACAATAACGATGAAGATACTAATAAGGAAGAGAA AGTGATGAGAAGTATTCTCAACCTGTTCAGACTATCCAGTTTGGCATTCC CTGGAGAAATTATTATGGAAGAGGCTAAAGCATTTAGCACTAGATATCTT AAAGAATTATTAGAAATTTCTAGAGATACATTTAACAGGAGTTTTATTAA AGAGGTGGAGTATGCTCTTACATATGAATGGCCTCGAACCTTTACTAGAT GGGAGGCGTGGAATTTCATAGAGATCTGTGATTTAGATAATGACAGGTTG GAAGACAAAAGGATTTTACAGCTTGCAAAATTGGATTTTAATATACTACA ATTTCAATATAAGTTGGAGATGAAAAATCTGTCAAGTTGGTGGGTTGAAT CTGGCATCTCCAATCTGGTTGCAACAAGGGCCCGACATATTGAATATCTT TTTTGGGCAGTTGCTTCTACAGATGAGATGGAGTTTTCTAGTAGTAGAAT AGCTCTTGCAAAGACCACCGCAATTATTACAGTAATGGATGACATTTTTG ATGACTATGCAACACTTGAGTATCTCAAATGTATTTCAGATGCCATTTCT AAAAATTGGGATGTTTCTATTATAGAAAATATTCCCAACAACTTGAAGAC ATGTTTTGAATTTATTTCTAAAACAGTTCATCAAATGGCAATAGATGCTA CTAAATATCAAGGACGTGACATGATGCCTTTTATTACAAAAGCGTGGGCA GATTATATAGAAGCCTGCTTTGAGGAGGCACGCTGGAAACTGACAGGATA TTTTCCAACCTACGATGAGTACATGAAATCTGCTGAACTATGTGTTGGAT TTGGACAGATATTTTTATCTAGTGGGCTACTAGCATCTCCTAATTTATGT GATGATGATATTGAGAAGATATACCTTGACAAATCTAGATTCTTTAAACT CATGCGAGTGTGTATGCGGTTGATTGATGATATAAATGATTTTGAGGATG AGAGGCTCCATGGAAAGATTGCCTCAGCTATTGCTTGTTACAAGGGTGAT CATCCAAATTGTTCAGAAAGCGAGGCCATCAATCAAATCATCACGCTCAA TAATAAATTATTGAGAGAATTGACAAGAGAATTTTTTAAATCAAATATGA ATTTTCTTGAATGGCAAAAGATATGTGTCAATAGTACCAGAGGAGTACAA TTTTTCTATATATTTAGAGATGGGTTTACATATTCTCACAAGGAGATCAA GCAGCAGATATTTAAAATCCTTGTTGATCCAATAAAAATGTAG SEQ ID NO: 8 JvCP1206-5, wild type cDNA sequence. ATGTCGAATTTGAAAGGAGACCACATTTCTTCTGTTTCTTCCATTCCAGC CCATGCTTTTAATGAGTGGGGCGATGCTTTTGTTCAATCTATGGAGATGC CGTACGGGGAACCTGAATACCGTGAACGTGCTGAAACACTTGTGAAACAA GTCAAAATCTTGTTAAAAGAAATGCAAACTGGAGATGGTGATCTAATCGA GCGGCTTGAGATGGTTGATGCTTTGCAATGCCTTGGCATTGAGCGATATT TTCAGGCTGAGATTAAAGAAGCTCTTGATTACGTTTACCGCTCTTGGGAT GGAACTGTGGGAATAGGATTAGGCTGCAACAGTGCTACAAAGCATTTGAA TGCCACAGCTTTGGGACTCAGAGTACTTCGACTCCATCGTTATGACGTCT CTCCAGACACGTTGCACAATTTCAAGGACAATACTGGGAAGTTCGTCCTC ACTGGAGAAAATAAAGACAATAACGATGAAGATACTAATAAGGAAGAGAA AGTGATGAGAAGTATTCTCAACCTGTTCAGACTATCCAGTTTGGCATTCC CTGGAGAAATTATTATGGAAGAGGCTAAAGCATTTAGCACTAGATATCTT AAAGAATTATTAGAAATTTCTAGAGATACATTTAACAGGAGTTTTATTAA AGAGGTGGAGTATGCTCTTACATATGAATGGCCTCGAACCTTTACTAGAT GGGAGGCCCGGAATTTCATAGAAATCTGTGATTTAGATAATGACAGGTTG AAAGATAAAAGGATTTTAGAGCTTGCAAAATTGGATTTTAATATACTACA ATTTCAATATCAGCTGGAGATGAAAAATCTCTCAAGGTGGTGGGTTGAAT CTGGCATCTCCAATCTAGTTGCAACAAGGGAGCGATCTATTGAATATCTT TTTTGGGCAGTTACTTCTACAGATGAGTTGGAATTTTCTAGTAGTAGAAT AGCTCATGCAAAGTGCACCACAATAATTACAATAATGGATGATATTTTTG ATGACTATGCAACACTTGAGCAACTCAAATGTATTGTAGATGCCATTTCA AAAAATTGGGATGTTTCTATTATAGAGAATATACCCAATAACTTGAAGAC ATGCTTTGAATTTGTTTCTAAAACAGTTCATGAATTGGCAATAGATGCTA CTGAATATCAAGGACGTGACATGATGCCTTTTATTACAAAAGCGTGGACA GATTATGGAGAAGCTTGCTTTGAGCAGGCATGCTGGAAAGTGAAAGGATA TTTTCCAACCTACAATGAGTACATAAAGTGTGCTGAATTAAGTGTTGCAT TTGGACCGATATTGTTACATACTGCACTACTAGCATCTCCCGATTTATGC GATGATGATATTGAGAAGATATACCTTGACAAATCTAGATTCTTTAAACT CATGCGAGTGTGTATGCGGTTGATTGATGATATAAATGATTTTGAGGATG AGAGGCTCCATGGAAAGATTGCCTCAGCTATTGCTTGTTACAAGGGTGAT CATCCAAATTGTTCAGAAAGCGAGGCCATCAATCAAATCATCACGCTCAA TAATAAATTATTGAGAGAATTGACAAGAGAATTTTTTAAATCAAATATGA ATTTTCTTGAATGGCAAAAGATATGTGTCAATAGTACCAGAGGAGTACAA TTTTTCTATATATTTAGAGATGGGTTTACATATTCTCACAAGGAGATCAA GCAGCAGATATTTAAAATCCTTGTTGATCCAATAAAAATGTAG SEQ ID NO: 9 JvCP1206-4, codon optimized cDNA sequence. ATGAGCAATTTGAAAGGCGATCACATCAGCAGCGTATCTAGCATTCCGGC ACATGCATTCAATGAATGGGGCGACGCCTTTGTTCAGAGCATGGAAATGC CGTACGGTGAGCCGGAATATCGCGAGCGTGCGGAGACTCTGGTCAAACAA GTGAAGATTCTGCTGAAAGAGATGCAAACCGGTGACGGCGACTTGATTGA ACGTCTGGAGATGGTGGATGCGCTGCAATGCCTGGGTATTGAGCGTTATT TCCAAGCGGAGATTAAAGAGGCGCTGGATTACGTGTACCGTAGCTGGGAC GGCACGGTGGGCATCGGTCTGGGTTGCAACTCGGCCACCAAGCATCTGAA CGCTACCGCTCTGGGCCTGCGTGTTCTGCGCCTGCATCGTTATGATGTGA GCCCTGACACCTTGTATAACTTTAAGGACAATACCGGCGAATTTGTCCTG TGTGGTGAGAACAAAGTTAGCAATGATGAAGATACTAACAAAGAAGAGAA GGTTATGCGCAGCATGTTGAATTTGCTGCGCCTGAGCTCTTTGGCTTTTC CGGGTGAGATCATCATGGAAGAAGCGCAGGCGTTTAGCACCCGTTATCTG AAAGAACTGCTGGAGATCTCTGGCGACACCTTTAATCGTAGCTTCATCAA AGAGGTCGAGTACGCGCTGACCTATGAATGGCCACGTACCTTCACCCGCT GGGAAGCATGGAATTTCATTGAAATTTGTGACCTGGACAACGACCGTCTG GAAGATAAGCGTATCCTGCAGCTGGCGAAGCTGGACTTCAACATCCTGCA GTTTCAGTACAAGCTGGAGATGAAGAATCTGAGCAGCTGGTGGGTTGAGA GCGGTATTTCCAACTTGGTCGCGACGCGTGCGCGCCACATCGAGTACTTG TTTTGGGCGGTCGCGTCTACGGACGAGATGGAGTTTTCCAGCTCCCGTAT CGCCCTGGCGAAAACCACGGCTATTATCACCGTTATGGATGACATTTTCG ATGATTACGCGACGCTGGAGTACCTGAAATGTATTTCCGACGCCATTAGC AAGAATTGGGATGTCAGCATTATTGAAAACATCCCGAACAATCTGAAAAC GTGCTTCGAGTTCATTAGCAAAACGGTGCACCAGATGGCCATTGATGCGA CGAAGTATCAGGGCCGTGACATGATGCCGTTTATCACTAAGGCCTGGGCT GATTACATTGAAGCCTGTTTCGAAGAAGCACGCTGGAAGCTGACGGGTTA CTTCCCGACCTATGATGAGTACATGAAAAGCGCGGAACTGTGCGTGGGTT TCGGTCAGATTTTTCTGAGCTCGGGCCTGTTGGCAAGCCCGAATTTGTGT GATGACGATATTGAGAAGATTTACCTGGATAAAAGCCGTTTCTTCAAGCT GATGCGCGTTTGCATGCGTCTGATCGATGACATCAACGACTTCGAGGACG AACGTCTGCACGGTAAGATCGCAAGCGCAATCGCATGCTATAAGGGTGAC CACCCGAATTGCAGCGAAAGCGAGGCAATTAACCAAATCATCACCTTGAA CAATAAACTGCTGCGCGAACTGACCCGCGAGTTTTTCAAGAGCAATATGA ACTTTCTGGAGTGGCAGAAAATCTGTGTGAACTCCACCCGTGGTGTCCAA TTCTTCTATATCTTTCGTGATGGTTTTACCTACTCTCACAAAGAGATTAA ACAACAAATCTTCAAAATTCTGGTTGACCCGATCAAGATGTAA SEQ ID NO: 10 JvCP1206-3, codon optimized cDNA sequence. ATGAGCAATTTGAAAGGCGATCACATCAGCAGCGTATCTAGCATTCCGGC ACATGCATTCAATGAGTGGGGTGATGCGTTCGTCCAAAGCATGGAAATGC CGTATGGTGAGCCGGAGTACCGTGAACGTGCTGAAACGCTGGTTAAACAA GTGAAGATTCTGCTGAAAGAAATGCAGACCGGCGATGGTGACCTGATCGA ACGCCTGGAGATGGTGGACGCACTGCAATGTCTGGGTATTGAGCGTTACT TTCAAGCCGAGATCAAAGAAGCGCTGGACTACGTGTACCGCAGCTGGGAT GGCACCGTCGGTATTGGTCTGGGTTGCAATAGCGCGACCAAGCACCTGAA TGCAACGGCGCTGGGTCTGCGCGTTCTGCGCCTGCACCGCTATGATGTTA GCCCGGATACTCTGCATAACTTCAAGGATAACACGGGTAAGTTTGTCCTG ACGGGCGAGAACAAAGACAATAACGACGAAGATACTAACAAAGAAGAGAA GGTTATGCGTTCCATTCTGAATCTGTTTCGTTTGAGCTCCCTGGCATTTC CGGGCGAGATCATTATGGAAGAGGCTAAAGCGTTCTCTACTCGTTACCTG AAAGAACTGCTGGAAATCAGCCGCGACACCTTCAATCGTAGCTTCATCAA AGAGGTTGAGTATGCTTTGACCTACGAGTGGCCTCGCACCTTTACGCGTT GGGAAGCGTGGAATTTCATCGAAATTTGCGACCTGGACAACGACCGTCTG GAAGATAAGCGTATCTTGCAGCTGGCAAAGCTGGACTTCAATATCCTGCA ATTTCAGTACAAACTGGAAATGAAGAATCTGTCCAGCTGGTGGGTCGAGA
GCGGTATTAGCAACCTGGTGGCGACGCGTGCGCGTCATATCGAATACTTG TTCTGGGCGGTCGCCAGCACGGACGAGATGGAGTTCAGCAGCTCTCGTAT TGCCCTGGCAAAGACCACCGCAATTATCACCGTGATGGATGACATTTTCG ATGACTACGCGACCCTGGAGTACCTGAAATGTATTTCGGATGCGATCAGC AAGAACTGGGATGTTTCCATTATTGAAAACATTCCGAACAACCTGAAAAC CTGTTTTGAGTTTATCAGCAAAACCGTTCACCAGATGGCGATCGATGCTA CGAAATATCAGGGTCGTGACATGATGCCATTCATTACGAAGGCGTGGGCC GACTATATTGAGGCATGTTTCGAAGAAGCGCGTTGGAAGCTGACGGGCTA CTTTCCGACCTACGACGAGTATATGAAGAGCGCGGAATTGTGCGTTGGTT TTGGTCAGATCTTTCTGAGCTCTGGCCTGTTGGCTTCCCCGAATCTGTGC GACGACGACATTGAGAAAATCTATTTGGACAAGTCCCGCTTCTTCAAGCT GATGCGTGTTTGTATGCGCTTGATCGATGACATTAACGATTTCGAGGATG AGCGTCTGCACGGCAAAATCGCCAGCGCCATCGCCTGCTATAAAGGCGAC CATCCGAATTGTAGCGAGTCTGAGGCGATCAACCAGATCGTGATGCTGAA TAACAAATTGCTGCGCGAACTGACCCGCGAGTTCCTGAAGAGCAATATGA ACTTTCTGGAGTGGGAGAAGATTTGCGTGAACAGCACCCGTGGTGTGCAA TTCTGCTACATTTTTGGCGATGGTTTTACCTATAGCCACAAAGAAATCAA ACAACAGATCTTTAAGATTCTGGTCAATCCGATCAAGGTCTAA SEQ ID NO: 11 JvCP1206-6, codon optimized cDNA sequence. ATGAGCAATTTGAAAGGCGATCACATCAGCAGCGTATCTAGCATTCCGGC ACATGCATTCAATGAGTGGGGTGACGCGTTTGTGCAGAGCATGGAAATGC CGTATGGTGAACCGGAATATCGTGAGCGTGCTGAAACCCTGGTGAAGCAA GTCAAGATTCTGTTGAAAGAAATGCAAACCGGCGACGGTGATCTGATCGA GCGCCTGGAGATGGTTGATGCGCTGCAGTGTCTGGGTATTGAGCGCTATT TTCAAGCCGAGATCAAAGAAGCGCTGGATTACGTTTATCGTAGCTGGGAT GGCACGGTTGGTATTGGCCTGGGCTGCAATAGCGCGACCAAGCACCTGAA CGCTACCGCGCTGGGTCTGCGCGTGTTGCGTTTGCACCGCTACGACGTTT CGCCGGATACTCTGCATAACTTTAAAGATAATACGGGCAAATTCGTCCTG ACGGGTGAGAACAAAGATAACAACGATGAGGACACGAACAAAGAAGAAAA AGTCATGCGCTCCATCCTGAATCTGTTTCGTCTGAGCAGCCTGGCTTTTC CTGGCGAGATCATTATGGAAGAAGCGAAGGCGTTTAGCACCCGTTACCTG AAAGAACTGTTGGAGATCAGCCGTGATACCTTCAACCGTAGCTTTATCAA AGAGGTGGAGTACGCGCTGACCTACGAGTGGCCGCGTACCTTTACCCGTT GGGAAGCCTGGAATTTCATTGAGATCTGCGACCTGGATAACGACCGTCTG GAAGATAAGCGTATTCTGCAATTGGCGAAACTGGACTTCAATATTCTGCA GTTCCAGTACAAGCTGGAGATGAAGAATCTGTCCAGCTGGTGGGTTGAGA GCGGTATCAGCAACCTGGTCGCGACGCGTGCACGTCATATCGAGTACCTG TTTTGGGCGGTCGCTAGCACGGACGAAATGGAGTTTAGCTCCAGCCGCAT TGCACTGGCCAAGACCACTGCAATCATTACCGTGATGGATGATATCTTTG ACGATTACGCGACCTTGGAGTATCTGAAATGCATCTCTGACGCGATCAGC AAGAACTGGGACGTTAGCATTATTGAAAACATTCCGAATAACTTGAAAAC GTGTTTTGAGTTCATTAGCAAAACTGTTCACCAAATGGCAATCGACGCCA CCAAATATCAGGGCCGTGACATGATGCCGTTTATCACCAAGGCCTGGGCA GACTACATCGAGGCATGCTTTGAAGAAGCTCGCTGGAAACTGACGGGTTA TTTCCCGACCTACGATGAGTACATGAAGTCCGCCGAGCTGTGCGTCGGCT TCGGTCAGATTTTCCTGTCGAGCGGTCTGCTGGCAAGCCCAAATCTGTGT GACGACGACATTGAAAAGATTTACTTGGACAAGAGCCGCTTTTTCAAGCT GATGCGTGTGTGTATGCGTCTGATTGATGACATTAACGATTTCGAGGACG AACGCCTGCACGGTAAGATCGCGTCCGCCATTGCGTGCTACAAGGGCGAC CATCCGAATTGCTCTGAATCTGAAGCGATTAACCAAATCATCACCCTGAA CAATAAACTGCTGCGTGAGTTGACCCGTGAGTTCTTCAAGTCTAACATGA ATTTTCTGGAGTGGCAGAAGATTTGTGTTAATAGCACGCGCGGTGTGCAA TTCTTCTATATCTTCCGCGATGGTTTCACGTATAGCCACAAAGAGATCAA GCAGCAGATTTTCAAAATCCTGGTGGACCCGATCAAAATGTAA SEQ ID NO: 12 JvCP1206-5, codon optimized cDNA sequence. ATGAGCAATTTGAAAGGCGATCACATCAGCAGCGTATCTAGCATTCCGGC ACATGCATTCAACGAGTGGGGCGACGCTTTCGTGCAATCTATGGAGATGC CGTATGGTGAGCCGGAGTACCGTGAGCGTGCGGAAACGCTGGTGAAACAA GTTAAGATCCTGCTGAAAGAGATGCAGACCGGTGATGGCGATCTGATTGA ACGTCTGGAGATGGTCGATGCGCTGCAATGCCTGGGTATCGAACGTTACT TCCAGGCGGAGATCAAAGAGGCCCTGGACTATGTTTACCGTAGCTGGGAT GGCACGGTCGGTATTGGTCTGGGTTGCAACAGCGCGACGAAACACCTGAA CGCGACGGCTCTGGGTCTGCGCGTTCTGCGCCTGCACCGTTACGATGTCA GCCCGGACACGCTGCATAACTTTAAGGACAATACGGGCAAATTTGTGCTG ACTGGTGAAAACAAAGATAACAACGACGAGGATACCAATAAAGAAGAAAA GGTCATGCGTTCCATCCTGAATTTGTTCCGCCTGAGCAGCTTGGCCTTTC CGGGCGAGATCATTATGGAAGAAGCGAAGGCGTTTAGCACCCGTTATCTG AAAGAACTGCTGGAAATTAGCCGCGACACCTTTAACCGCAGCTTTATCAA AGAAGTCGAATACGCCCTGACCTACGAGTGGCCGCGTACCTTTACCCGTT GGGAAGCGCGTAATTTCATTGAAATCTGTGATTTGGATAATGACCGTCTG AAGGATAAGCGTATCCTGGAGCTGGCGAAGCTGGACTTTAACATTTTGCA GTTCCAATATCAGTTGGAGATGAAAAATCTGAGCCGCTGGTGGGTGGAGA GCGGTATTAGCAACTTGGTTGCCACTCGTGAGCGTTCCATTGAATACCTG TTCTGGGCGGTCACGTCTACCGACGAACTGGAGTTTAGCTCTAGCCGCAT CGCGCACGCGAAATGCACCACGATCATCACCATCATGGATGATATCTTTG ACGATTATGCAACCCTGGAGCAACTGAAGTGTATTGTGGACGCTATTTCG AAGAACTGGGACGTTTCCATCATTGAGAACATTCCGAATAATCTGAAAAC CTGTTTCGAGTTCGTGAGCAAAACCGTTCACGAGCTGGCAATTGATGCCA CCGAGTATCAAGGTCGTGACATGATGCCGTTCATCACCAAGGCCTGGACC GATTATGGTGAAGCATGTTTCGAGCAGGCTTGCTGGAAGGTGAAGGGTTA CTTTCCTACCTACAACGAGTATATCAAGTGCGCAGAACTGAGCGTCGCCT TTGGCCCGATTCTGCTGCATACGGCGCTGTTGGCGAGCCCAGACCTGTGC GACGATGACATTGAGAAAATCTATTTGGACAAGTCGCGCTTCTTTAAACT GATGCGCGTTTGTATGCGCCTGATTGACGACATTAATGACTTCGAGGATG AGCGCTTGCACGGCAAGATTGCAAGCGCGATTGCATGCTACAAGGGTGAT CATCCGAATTGCAGCGAATCCGAGGCAATCAACCAGATCATTACTCTGAA CAATAAACTGCTGCGTGAACTGACGCGTGAGTTCTTTAAGAGCAATATGA ATTTTCTGGAATGGCAGAAGATTTGTGTTAACTCCACCCGTGGCGTTCAG TTCTTCTACATCTTCCGTGACGGTTTCACCTACAGCCACAAAGAAATCAA ACAGCAAATCTTCAAAATCCTGGTGGACCCGATCAAGATGTAA SEQ ID NO: 13 Por B1, amino acid sequence MSNLMGDHISSLSSIPSNAFNQWDDAFIQSMETPYGEPEYRERAETLAKE IKIFLKDMQSGGGDGDLIERLEIVDALQCLGIDRYFQAEIKAALDYVYNC WDESVGIGLGSQSATKDLNATALALRVFRLNRYDVSADTLKYFKDNNGRF VLCGDNKDNNDEDNSKEEKVMRSMLNLLRLSSLAFPAEIVMEEAKAFSSR YLKELLGKSGDTSKKSFLKEVEYALIYEWPRTFIRWEARNFIEIYELDNE RLKEKRILELAKLDFNILQFHYKLEMKNLSSWWVESEISKLIATRERSIE YLLWAISSMDELEHSSSRIALAKITSLITILDDIFDDYATFEQLKCIRDA IFKGWDVSIIENIPNNWKRCVEFVFKTIHQLTIDATDYQGRDMMPFVSKA WEDYVEACFEQARWKLKGYFPTYNEYIKIAGKCVGFGPFSLHSAILASPN LCDDDIQKIYLDKSRFYQLMRVAMRLIDDIHDFEEERLHGKMASAISCYM ADHPNCSEKEAMNHIIELNNEVLKELTREFLKPSMIFHEWEKIFVNSTRG VQFFYVHGDGFTYTHKEIKHQILKIIVDPIKI SEQ ID NO: 14 Por2-3-5, amino acid sequence MSTLEGDNIYSVSSLPAHAFNEWEDASVQSMEMSYGEPEYRERAETLVKE VKILLKEMHTGDGDLIERLEMVDALQCLGIYRYFQAEIKQALDYVYSCWD GNVGIGLGSESPTQHLNATALGIRVLRLHRYDVSADTLKNFKDKNGQFVL CGGNNDNNDEEEKVMRSMLNLFRLSSVAIPGEMVLEEAKAFSSRYLKELL ENSGDTVKRSFIKEVEYALTYEWPITFDRWEALNFIEIYDLNNERLMDKR ILELAKLNFNILQFQYKLEMKNLSSWWAKSGISKLLAVRERSIEYLFWAI TSVEELELSSSRIALVKCTTVITIVDDIFDDYATFEQLQCITDAISKDWD VSLLENIPSNLKTSLEFVSKTIHELAMDATKYQGRDMMPFVTKAWLDYTN ACFEQARWKVTGYFPSYNEYIKAAELSVAFGPILLHTALAASPILCDEDI EKIYLDKSRFYHIMRVSMRLTDDIHDFEDERLHGKMASAISCYKGDHPNC SEEEAINNIVTLNNELLKEMIREFFKPNSHYLEWEKICVNSTRGIGFFYI FGDGFTYSHKEIKEQIFKIIVNPIKV SEQ ID NO: 15 PorB1, coding DNA sequence (wild type) ATGTCTAATTTGATGGGAGATCACATTTCTTCTCTTTCTTCCATTCCATC CAATGCTTTCAATCAGTGGGACGATGCGTTTATTCAATCTATGGAGACGC CATACGGGGAACCTGAATACCGTGAACGTGCTGAAACACTTGCTAAGGAA ATAAAAATCTTTTTAAAAGACATGCAATCTGGAGGTGGAGATGGCGATCT AATCGAGCGGCTTGAGATTGTTGACGCCTTGCAATGCCTCGGAATAGATC GTTATTTTCAGGCTGAAATAAAAGCGGCTCTTGATTACGTTTATAACTGT TGGGATGAAAGTGTGGGGATAGGATTAGGGAGCCAAAGTGCTACAAAGGA TTTGAATGCTACAGCTTTAGCACTTCGAGTGTTTCGACTTAATCGTTATG ATGTGTCTGCAGACACGTTGAAGTATTTCAAGGATAATAATGGGCGGTTC
GTACTCTGTGGAGACAATAAAGACAACAACGACGAGGATAATAGCAAAGA AGAAAAAGTGATGAGAAGTATGCTCAACCTGTTAAGACTTTCCAGTTTGG CATTTCCTGCAGAAATCGTTATGGAAGAGGCTAAAGCATTCAGTTCTAGA TATCTTAAAGAACTATTAGGAAAATCTGGAGATACATCTAAGAAAAGTTT TCTTAAAGAGGTGGAGTATGCCCTTATATATGAATGGCCTCGAACATTTA TTAGATGGGAGGCACGAAATTTCATAGAAATCTATGAACTAGATAATGAG AGGTTAAAAGAGAAAAGGATTTTAGAACTTGCGAAATTGGATTTTAACAT ACTACAATTTCACTACAAGCTAGAGATGAAAAATCTCTCAAGTTGGTGGG TTGAATCTGAAATCTCCAAGCTAATTGCAACAAGAGAACGATCCATTGAA TATCTTTTGTGGGCAATTAGTTCTATGGATGAATTGGAGCATTCTAGTAG TAGAATAGCTCTTGCAAAAATCACATCACTTATCACAATATTGGATGATA TTTTTGATGACTATGCAACATTTGAGCAACTCAAATGCATTAGGGATGCC ATTTTTAAAGGTTGGGATGTTTCTATCATAGAAAACATTCCCAACAACTG GAAAAGATGCGTGGAATTTGTTTTTAAAACAATTCATCAATTGACAATAG ATGCTACTGATTATCAAGGGCGTGACATGATGCCTTTTGTTTCAAAAGCG TGGGAAGATTATGTGGAAGCCTGCTTTGAGCAGGCACGATGGAAATTGAA AGGATATTTTCCAACCTACAATGAGTACATAAAGATAGCTGGAAAATGTG TAGGGTTTGGACCCTTTTCTTTACATTCTGCCATACTAGCATCTCCAAAT TTATGTGATGATGATATTCAGAAGATATACCTTGATAAATCTAGATTTTA TCAACTCATGCGAGTGGCTATGAGGTTAATTGATGATATACACGACTTTG AGGAAGAGAGACTCCATGGAAAGATGGCCTCAGCTATTTCTTGTTATATG GCTGATCATCCAAATTGTTCAGAGAAAGAGGCAATGAATCATATCATCGA ACTAAATAATGAAGTATTGAAGGAATTGACAAGAGAATTTTTAAAACCAA GTATGATATTTCATGAGTGGGAGAAGATATTTGTCAATTCTACTCGAGGA GTACAATTTTTCTATGTACATGGTGATGGATTTACATATACGCATAAGGA GATCAAGCATCAGATACTAAAAATTATTGTCGATCCAATAAAAATCTAG SEQ ID NO: 16 Por2-3-5, coding DNA sequence (wild type) ATGTCGACTTTGGAAGGAGACAACATTTATTCTGTTTCTTCCTTACCAGC CCATGCTTTTAATGAGTGGGAAGATGCTTCTGTTCAATCTATGGAGATGT CATACGGGGAACCTGAATACCGTGAACGTGCTGAAACACTTGTGAAAGAA GTAAAAATCTTGTTGAAAGAAATGCACACTGGAGATGGCGATCTAATCGA GCGGCTTGAGATGGTTGATGCATTGCAATGCCTTGGAATTTATCGATACT TTCAGGCTGAGATTAAACAAGCTCTTGATTACGTTTACAGCTGCTGGGAT GGAAATGTGGGGATAGGATTAGGCTCCGAGAGTCCTACACAGCATTTGAA TGCCACAGCTTTGGGAATCAGAGTACTGCGACTCCATCGTTATGATGTGT CTGCAGACACGTTGAAGAATTTCAAGGACAAAAATGGGCAGTTCGTACTC TGTGGAGGAAATAATGACAATAACGATGAGGAAGAGAAAGTGATGAGAAG TATGCTCAACCTGTTCAGACTTTCCAGTGTGGCAATTCCTGGAGAAATGG TTCTGGAAGAGGCTAAAGCATTTAGCAGTAGATATCTTAAAGAATTATTA GAAAATTCTGGAGATACAGTTAAGAGAAGTTTTATTAAAGAGGTGGAGTA TGCTCTTACCTATGAATGGCCTATAACTTTTGATAGATGGGAGGCACTGA ATTTCATAGAAATCTATGATTTAAATAATGAGAGGTTGATGGACAAAAGG ATATTAGAGCTTGCAAAATTGAATTTTAATATACTACAATTTCAATACAA GTTGGAGATGAAAAATCTCTCAAGTTGGTGGGCTAAATCTGGCATCTCGA AACTACTTGCAGTAAGGGAGCGATCCATTGAATATCTTTTTTGGGCAATT ACTTCTGTAGAAGAATTGGAGCTTTCTAGTAGTAGAATAGCTCTTGTAAA GTGCACAACAGTTATTACAATAGTGGATGATATTTTTGATGACTATGCAA CATTTGAGCAACTCCAATGTATTACAGATGCTATCTCTAAAGATTGGGAT GTTTCTCTTTTAGAAAACATTCCCAGCAACTTGAAGACAAGCTTGGAATT TGTTTCAAAAACAATTCATGAGTTGGCAATGGATGCTACTAAATATCAAG GGCGTGACATGATGCCTTTTGTTACAAAAGCGTGGTTAGATTACACGAAC GCCTGCTTTGAGCAAGCACGATGGAAAGTGACTGGTTATTTTCCAAGCTA CAATGAGTACATAAAGGCTGCTGAATTAAGTGTAGCATTTGGACCGATAT TGTTACATACTGCCCTAGCAGCATCTCCTATTTTATGCGATGAAGATATT GAGAAGATATACCTTGATAAATCTAGATTCTATCATATCATGCGAGTGTC TATGCGGTTGACTGATGATATACATGATTTTGAGGATGAGAGGCTGCATG GAAAGATGGCTTCAGCTATTTCTTGTTATAAGGGTGATCATCCAAATTGT TCAGAAGAAGAGGCAATAAATAATATTGTCACCCTCAATAATGAATTATT GAAGGAAATGATAAGGGAATTTTTTAAACCAAATAGTCATTATCTTGAAT GGGAAAAGATATGTGTCAATAGTACTAGAGGAATAGGATTTTTCTATATA TTTGGAGATGGGTTTACATATTCTCACAAGGAAATCAAGGAGCAGATATT TAAAATTATTGTTAATCCAATAAAAGTGTAG SEQ ID NO: 17 PorB1, coding DNA sequence (optimised by Genscript genetic codon frequency of E. coli) ATGTCCAACCTGATGGGCGATCATATTAGCTCTCTGAGTTCCATCCCGTC CAACGCTTTTAATCAGTGGGATGACGCGTTCATTCAATCAATGGAAACCC CGTATGGTGAACCGGAATACCGTGAACGCGCTGAAACGCTGGCGAAAGAA ATCAAAATCTTCCTGAAAGATATGCAGTCTGGCGGTGGCGACGGCGATCT GATTGAACGTCTGGAAATCGTGGACGCCCTGCAGTGCCTGGGTATTGATC GCTATTTTCAAGCAGAAATCAAAGCGGCCCTGGACTATGTTTACAACTGT TGGGATGAATCGGTCGGTATTGGCCTGGGTTCCCAATCAGCCACCAAAGA TCTGAACGCAACGGCTCTGGCGCTGCGTGTGTTTCGCCTGAATCGTTATG ACGTTTCTGCGGATACCCTGAAATACTTCAAAGATAACAACGGCCGTTTC GTTCTGTGCGGTGACAACAAAGATAACAACGACGAAGATAACTCTAAAGA AGAAAAAGTCATGCGTAGTATGCTGAATCTGCTGCGCCTGTCATCGCTGG CTTTCCCGGCGGAAATTGTCATGGAAGAAGCCAAAGCATTTAGCTCTCGC TATCTGAAAGAACTGCTGGGCAAAAGCGGTGATACCAGCAAAAAATCTTT TCTGAAAGAAGTGGAATACGCCCTGATTTACGAATGGCCGCGCACGTTCA TCCGTTGGGAAGCACGCAACTTCATCGAAATCTACGAACTGGACAACGAA CGTCTGAAAGAAAAACGCATTCTGGAACTGGCGAAACTGGATTTTAACAT CCTGCAGTTCCATTACAAACTGGAAATGAAAAACCTGAGTTCCTGGTGGG TGGAATCTGAAATTAGTAAACTGATCGCTACCCGTGAACGCTCCATTGAA TATCTGCTGTGGGCGATCTCATCGATGGATGAACTGGAACACAGCTCTAG TCGTATTGCTCTGGCGAAAATCACCTCACTGATTACGATCCTGGATGACA TTTTTGATGACTACGCTACCTTCGAACAGCTGAAATGCATTCGTGACGCG ATCTTCAAAGGCTGGGATGTTAGTATTATCGAAAACATCCCGAACAATTG GAAACGCTGTGTGGAATTTGTTTTCAAAACGATTCATCAGCTGACCATCG ACGCTACGGATTATCAAGGTCGTGACATGATGCCGTTTGTCAGCAAAGCA TGGGAAGATTATGTGGAAGCCTGTTTCGAACAGGCACGCTGGAAACTGAA AGGCTACTTTCCGACCTATAACGAATACATTAAAATCGCCGGTAAATGCG TTGGCTTTGGTCCGTTCTCCCTGCACTCAGCCATTCTGGCATCTCCGAAT CTGTGTGATGACGATATCCAGAAAATCTACCTGGATAAAAGTCGTTTCTA CCAACTGATGCGTGTCGCGATGCGCCTGATTGACGATATCCATGATTTTG AAGAAGAACGCCTGCACGGCAAAATGGCCTCGGCAATTAGCTGCTATATG GCCGATCATCCGAACTGTAGCGAAAAAGAAGCAATGAATCACATTATCGA ACTGAACAATGAAGTGCTGAAAGAACTGACCCGTGAATTTCTGAAACCGT CGATGATCTTCCATGAATGGGAAAAAATCTTCGTTAACAGCACGCGCGGT GTCCAGTTTTTCTATGTGCACGGCGACGGTTTCACCTACACGCATAAAGA AATCAAACACCAAATCCTGAAAATTATCGTTGATCCGATTAAAATCTAA SEQ ID NO: 18 PorB1, coding DNA sequence (optimised by DNA2.0 genetic codon frequency of E. coli) ATGTCTAATTTGATGGGTGATCACATTTCGAGCCTGAGCAGCATTCCGAG CAACGCATTCAATCAGTGGGATGACGCATTCATCCAGTCGATGGAAACCC CGTATGGTGAGCCGGAGTACCGTGAGCGTGCGGAAACCCTGGCAAAAGAA ATCAAGATTTTTCTGAAAGACATGCAGAGCGGCGGCGGCGATGGCGATCT GATCGAGCGTTTGGAAATCGTGGATGCGCTGCAATGCCTGGGTATCGACC GTTACTTCCAAGCCGAGATCAAAGCTGCCCTGGACTACGTTTATAATTGT TGGGACGAGTCTGTTGGCATTGGTCTGGGTAGCCAGAGCGCCACTAAAGA TCTGAACGCAACGGCGCTGGCGCTCCGTGTTTTCCGCTTGAACCGTTACG ACGTCAGCGCGGACACCTTAAAGTATTTCAAAGATAACAACGGTCGTTTT GTGCTGTGTGGCGATAATAAAGACAACAATGACGAAGATAACAGCAAAGA AGAAAAAGTCATGCGCAGCATGCTGAATTTGCTGCGTCTGAGCAGCCTGG CGTTTCCTGCTGAGATTGTCATGGAAGAAGCAAAGGCCTTTAGCTCTCGT TATCTGAAAGAACTGCTGGGTAAGAGCGGCGATACCAGCAAAAAGTCGTT TTTGAAAGAAGTGGAGTACGCACTGATTTATGAGTGGCCGCGTACCTTCA TCCGCTGGGAGGCACGCAACTTTATCGAGATCTACGAACTGGACAACGAA CGCCTGAAAGAAAAGCGTATCTTGGAACTGGCGAAACTGGACTTCAACAT TCTGCAGTTCCACTATAAACTGGAGATGAAGAATTTGTCCTCCTGGTGGG TGGAGTCCGAGATCAGCAAGCTGATTGCGACGCGTGAGCGTAGCATTGAG TATCTGCTGTGGGCTATTAGCAGCATGGACGAACTGGAGCACTCCAGCAG CCGTATCGCCCTGGCGAAGATTACCTCTCTGATTACCATTCTGGATGATA TTTTTGACGACTACGCGACCTTTGAGCAACTGAAGTGCATCCGCGACGCC ATCTTCAAGGGCTGGGATGTTAGCATCATTGAGAACATCCCGAACAATTG GAAACGTTGTGTTGAATTTGTCTTTAAGACGATTCATCAACTGACCATCG ACGCTACGGACTACCAGGGTCGCGACATGATGCCGTTCGTGAGCAAAGCG TGGGAAGATTATGTTGAGGCGTGCTTCGAGCAAGCGCGTTGGAAGCTGAA
GGGTTACTTTCCGACGTACAACGAATACATCAAGATCGCGGGTAAATGCG TCGGTTTCGGTCCATTCTCCCTTCATAGCGCGATTTTGGCGAGCCCGAAC CTGTGCGATGACGACATCCAAAAGATCTATCTGGATAAGAGCCGTTTTTA TCAATTGATGCGCGTCGCGATGCGTCTGATTGACGACATTCACGACTTTG AAGAGGAACGCCTGCACGGTAAAATGGCCTCCGCGATCAGCTGCTACATG GCAGATCACCCGAACTGTTCAGAGAAAGAGGCAATGAACCACATTATTGA GTTGAATAATGAAGTCCTGAAAGAACTGACCCGTGAGTTCCTGAAACCGA GCATGATCTTCCATGAGTGGGAAAAGATCTTTGTGAATAGCACGCGCGGT GTGCAATTCTTTTACGTTCACGGCGATGGCTTCACCTACACGCATAAAGA AATCAAGCATCAGATTCTGAAGATTATCGTGGACCCGATTAAGATTTAA SEQ ID NO: 19 Por2-3-5, coding DNA sequence (optimised by Genscript genetic codon frequency of E. coli) ATGAGCACCCTGGAAGGCGACAACATCTACAGCGTGAGCAGCCTGCCGGC GCACGCGTTCAACGAGTGGGAAGATGCGAGCGTTCAGAGCATGGAGATGA GCTACGGTGAACCGGAATATCGTGAGCGTGCGGAAACCCTGGTGAAGGAA GTTAAAATCCTGCTGAAGGAGATGCACACCGGTGACGGCGATCTGATTGA GCGTCTGGAAATGGTGGACGCGCTGCAATGCCTGGGCATCTACCGTTATT TTCAGGCGGAAATTAAACAAGCGCTGGACTACGTGTATAGCTGCTGGGAT GGCAACGTTGGTATCGGTCTGGGTAGCGAGAGCCCGACCCAGCACCTGAA CGCGACCGCGCTGGGTATTCGTGTGCTGCGTCTGCACCGTTACGACGTTA GCGCGGATACCCTGAAGAACTTCAAGGATAAAAACGGTCAATTTGTGCTG TGCGGTGGCAACAACGACAACAACGATGAGGAAGAGAAAGTTATGCGTAG CATGCTGAACCTGTTCCGTCTGAGCAGCGTGGCGATCCCGGGTGAAATGG TTCTGGAAGAGGCGAAGGCGTTTAGCAGCCGTTATCTGAAAGAGCTGCTG GAAAACAGCGGTGACACCGTGAAGCGTAGCTTCATCAAAGAGGTTGAATA CGCGCTGACCTATGAGTGGCCGATTACCTTCGATCGTTGGGAAGCGCTGA ACTTTATCGAGATTTACGACCTGAACAACGAACGTCTGATGGATAAGCGT ATCCTGGAGCTGGCGAAACTGAACTTCAACATTCTGCAGTTTCAATATAA GCTGGAAATGAAAAACCTGAGCTCCTGGTGGGCGAAGAGCGGCATCAGCA AACTGCTGGCGGTTCGTGAGCGTAGCATCGAATACCTGTTTTGGGCGATT ACCAGCGTGGAAGAGCTGGAGCTGAGCAGCAGCCGTATCGCGCTGGTTAA GTGCACCACCGTGATCACCATTGTTGACGATATTTTCGACGATTATGCGA CCTTTGAACAGCTGCAATGCATCACCGACGCGATTAGCAAAGACTGGGAT GTGAGCCTGCTGGAGAACATCCCGAGCAACCTGAAGACCAGCCTGGAATT CGTTAGCAAAACCATTCACGAGCTGGCGATGGACGCGACCAAGTACCAGG GTCGTGATATGATGCCGTTTGTGACCAAAGCGTGGCTGGATTACACCAAC GCGTGCTTCGAGCAAGCGCGTTGGAAGGTGACCGGCTATTTTCCGAGCTA CAACGAATATATCAAAGCGGCGGAGCTGAGCGTTGCGTTCGGTCCGATCC TGCTGCACACCGCGCTGGCGGCGAGCCCGATTCTGTGCGACGAGGATATC GAAAAGATTTACCTGGACAAAAGCCGTTTCTATCACATCATGCGTGTTAG CATGCGTCTGACCGACGATATTCACGACTTTGAGGATGAACGTCTGCACG GCAAGATGGCGAGCGCGATTAGCTGCTACAAAGGTGATCACCCGAACTGC AGCGAAGAGGAAGCGATCAACAACATTGTGACCCTGAACAACGAGCTGCT GAAGGAAATGATCCGTGAGTTCTTTAAACCGAACAGCCACTATCTGGAGT GGGAAAAGATTTGCGTTAACAGCACCCGTGGCATCGGTTTCTTTTACATT TTCGGCGACGGTTTTACCTATAGCCACAAGGAGATCAAAGAACAGATTTT CAAGATCATTGTGAACCCGATCAAAGTTTAA SEQ ID NO: 20 Forward primer TTTAAGTGCTTCTGCGATG SEQ ID NO: 21 Reverse primer ACATCTAGGTTTGTGCCTT SEQ ID NO: 22 Gene specific reverse primer ATCGCCATCTCCAGTGTG SEQ ID NO: 23 Forward primer CTTTAGTGCTTCTGTGATG SEQ ID NO: 24 Reverse primer CATACAAGTTTGTGCCTCA
SEQUENCE LISTINGS
1
241580PRTJuniperus virginiana 1Met Ser Asn Leu Lys Gly Asp His Ile Ser Ser Val Ser Ser Ile Pro1 5 10 15Ala His Ala Phe Asn Glu Trp Gly Asp Ala Phe Val Gln Ser Met Glu 20 25 30Met Pro Tyr Gly Glu Pro Glu Tyr Arg Glu Arg Ala Glu Thr Leu Val 35 40 45Lys Gln Val Lys Ile Leu Leu Lys Glu Met Gln Thr Gly Asp Gly Asp 50 55 60Leu Ile Glu Arg Leu Glu Met Val Asp Ala Leu Gln Cys Leu Gly Ile65 70 75 80Glu Arg Tyr Phe Gln Ala Glu Ile Lys Glu Ala Leu Asp Tyr Val Tyr 85 90 95Arg Ser Trp Asp Gly Thr Val Gly Ile Gly Leu Gly Cys Asn Ser Ala 100 105 110Thr Lys His Leu Asn Ala Thr Ala Leu Gly Leu Arg Val Leu Arg Leu 115 120 125His Arg Tyr Asp Val Ser Pro Asp Thr Leu Tyr Asn Phe Lys Asp Asn 130 135 140Thr Gly Glu Phe Val Leu Cys Gly Glu Asn Lys Val Ser Asn Asp Glu145 150 155 160Asp Thr Asn Lys Glu Glu Lys Val Met Arg Ser Met Leu Asn Leu Leu 165 170 175Arg Leu Ser Ser Leu Ala Phe Pro Gly Glu Ile Ile Met Glu Glu Ala 180 185 190Gln Ala Phe Ser Thr Arg Tyr Leu Lys Glu Leu Leu Glu Ile Ser Gly 195 200 205Asp Thr Phe Asn Arg Ser Phe Ile Lys Glu Val Glu Tyr Ala Leu Thr 210 215 220Tyr Glu Trp Pro Arg Thr Phe Thr Arg Trp Glu Ala Trp Asn Phe Ile225 230 235 240Glu Ile Cys Asp Leu Asp Asn Asp Arg Leu Glu Asp Lys Arg Ile Leu 245 250 255Gln Leu Ala Lys Leu Asp Phe Asn Ile Leu Gln Phe Gln Tyr Lys Leu 260 265 270Glu Met Lys Asn Leu Ser Ser Trp Trp Val Glu Ser Gly Ile Ser Asn 275 280 285Leu Val Ala Thr Arg Ala Arg His Ile Glu Tyr Leu Phe Trp Ala Val 290 295 300Ala Ser Thr Asp Glu Met Glu Phe Ser Ser Ser Arg Ile Ala Leu Ala305 310 315 320Lys Thr Thr Ala Ile Ile Thr Val Met Asp Asp Ile Phe Asp Asp Tyr 325 330 335Ala Thr Leu Glu Tyr Leu Lys Cys Ile Ser Asp Ala Ile Ser Lys Asn 340 345 350Trp Asp Val Ser Ile Ile Glu Asn Ile Pro Asn Asn Leu Lys Thr Cys 355 360 365Phe Glu Phe Ile Ser Lys Thr Val His Gln Met Ala Ile Asp Ala Thr 370 375 380Lys Tyr Gln Gly Arg Asp Met Met Pro Phe Ile Thr Lys Ala Trp Ala385 390 395 400Asp Tyr Ile Glu Ala Cys Phe Glu Glu Ala Arg Trp Lys Leu Thr Gly 405 410 415Tyr Phe Pro Thr Tyr Asp Glu Tyr Met Lys Ser Ala Glu Leu Cys Val 420 425 430Gly Phe Gly Gln Ile Phe Leu Ser Ser Gly Leu Leu Ala Ser Pro Asn 435 440 445Leu Cys Asp Asp Asp Ile Glu Lys Ile Tyr Leu Asp Lys Ser Arg Phe 450 455 460Phe Lys Leu Met Arg Val Cys Met Arg Leu Ile Asp Asp Ile Asn Asp465 470 475 480Phe Glu Asp Glu Arg Leu His Gly Lys Ile Ala Ser Ala Ile Ala Cys 485 490 495Tyr Lys Gly Asp His Pro Asn Cys Ser Glu Ser Glu Ala Ile Asn Gln 500 505 510Ile Ile Thr Leu Asn Asn Lys Leu Leu Arg Glu Leu Thr Arg Glu Phe 515 520 525Phe Lys Ser Asn Met Asn Phe Leu Glu Trp Gln Lys Ile Cys Val Asn 530 535 540Ser Thr Arg Gly Val Gln Phe Phe Tyr Ile Phe Arg Asp Gly Phe Thr545 550 555 560Tyr Ser His Lys Glu Ile Lys Gln Gln Ile Phe Lys Ile Leu Val Asp 565 570 575Pro Ile Lys Met 5802580PRTJuniperus virginiana 2Met Ser Asn Leu Lys Gly Asp His Ile Ser Ser Val Ser Ser Ile Pro1 5 10 15Ala His Ala Phe Asn Glu Trp Gly Asp Ala Phe Val Gln Ser Met Glu 20 25 30Met Pro Tyr Gly Glu Pro Glu Tyr Arg Glu Arg Ala Glu Thr Leu Val 35 40 45Lys Gln Val Lys Ile Leu Leu Lys Glu Met Gln Thr Gly Asp Gly Asp 50 55 60Leu Ile Glu Arg Leu Glu Met Val Asp Ala Leu Gln Cys Leu Gly Ile65 70 75 80Glu Arg Tyr Phe Gln Ala Glu Ile Lys Glu Ala Leu Asp Tyr Val Tyr 85 90 95Arg Ser Trp Asp Gly Thr Val Gly Ile Gly Leu Gly Cys Asn Ser Ala 100 105 110Thr Lys His Leu Asn Ala Thr Ala Leu Gly Leu Arg Val Leu Arg Leu 115 120 125His Arg Tyr Asp Val Ser Pro Asp Thr Leu His Asn Phe Lys Asp Asn 130 135 140Thr Gly Lys Phe Val Leu Thr Gly Glu Asn Lys Asp Asn Asn Asp Glu145 150 155 160Asp Thr Asn Lys Glu Glu Lys Val Met Arg Ser Ile Leu Asn Leu Phe 165 170 175Arg Leu Ser Ser Leu Ala Phe Pro Gly Glu Ile Ile Met Glu Glu Ala 180 185 190Lys Ala Phe Ser Thr Arg Tyr Leu Lys Glu Leu Leu Glu Ile Ser Arg 195 200 205Asp Thr Phe Asn Arg Ser Phe Ile Lys Glu Val Glu Tyr Ala Leu Thr 210 215 220Tyr Glu Trp Pro Arg Thr Phe Thr Arg Trp Glu Ala Trp Asn Phe Ile225 230 235 240Glu Ile Cys Asp Leu Asp Asn Asp Arg Leu Glu Asp Lys Arg Ile Leu 245 250 255Gln Leu Ala Lys Leu Asp Phe Asn Ile Leu Gln Phe Gln Tyr Lys Leu 260 265 270Glu Met Lys Asn Leu Ser Ser Trp Trp Val Glu Ser Gly Ile Ser Asn 275 280 285Leu Val Ala Thr Arg Ala Arg His Ile Glu Tyr Leu Phe Trp Ala Val 290 295 300Ala Ser Thr Asp Glu Met Glu Phe Ser Ser Ser Arg Ile Ala Leu Ala305 310 315 320Lys Thr Thr Ala Ile Ile Thr Val Met Asp Asp Ile Phe Asp Asp Tyr 325 330 335Ala Thr Leu Glu Tyr Leu Lys Cys Ile Ser Asp Ala Ile Ser Lys Asn 340 345 350Trp Asp Val Ser Ile Ile Glu Asn Ile Pro Asn Asn Leu Lys Thr Cys 355 360 365Phe Glu Phe Ile Ser Lys Thr Val His Gln Met Ala Ile Asp Ala Thr 370 375 380Lys Tyr Gln Gly Arg Asp Met Met Pro Phe Ile Thr Lys Ala Trp Ala385 390 395 400Asp Tyr Ile Glu Ala Cys Phe Glu Glu Ala Arg Trp Lys Leu Thr Gly 405 410 415Tyr Phe Pro Thr Tyr Asp Glu Tyr Met Lys Ser Ala Glu Leu Cys Val 420 425 430Gly Phe Gly Gln Ile Phe Leu Ser Ser Gly Leu Leu Ala Ser Pro Asn 435 440 445Leu Cys Asp Asp Asp Ile Glu Lys Ile Tyr Leu Asp Lys Ser Arg Phe 450 455 460Phe Lys Leu Met Arg Val Cys Met Arg Leu Ile Asp Asp Ile Asn Asp465 470 475 480Phe Glu Asp Glu Arg Leu His Gly Lys Ile Ala Ser Ala Ile Ala Cys 485 490 495Tyr Lys Gly Asp His Pro Asn Cys Ser Glu Ser Glu Ala Ile Asn Gln 500 505 510Ile Val Met Leu Asn Asn Lys Leu Leu Arg Glu Leu Thr Arg Glu Phe 515 520 525Leu Lys Ser Asn Met Asn Phe Leu Glu Trp Glu Lys Ile Cys Val Asn 530 535 540Ser Thr Arg Gly Val Gln Phe Cys Tyr Ile Phe Gly Asp Gly Phe Thr545 550 555 560Tyr Ser His Lys Glu Ile Lys Gln Gln Ile Phe Lys Ile Leu Val Asn 565 570 575Pro Ile Lys Val 5803580PRTJuniperus virginiana 3Met Ser Asn Leu Lys Gly Asp His Ile Ser Ser Val Ser Ser Ile Pro1 5 10 15Ala His Ala Phe Asn Glu Trp Gly Asp Ala Phe Val Gln Ser Met Glu 20 25 30Met Pro Tyr Gly Glu Pro Glu Tyr Arg Glu Arg Ala Glu Thr Leu Val 35 40 45Lys Gln Val Lys Ile Leu Leu Lys Glu Met Gln Thr Gly Asp Gly Asp 50 55 60Leu Ile Glu Arg Leu Glu Met Val Asp Ala Leu Gln Cys Leu Gly Ile65 70 75 80Glu Arg Tyr Phe Gln Ala Glu Ile Lys Glu Ala Leu Asp Tyr Val Tyr 85 90 95Arg Ser Trp Asp Gly Thr Val Gly Ile Gly Leu Gly Cys Asn Ser Ala 100 105 110Thr Lys His Leu Asn Ala Thr Ala Leu Gly Leu Arg Val Leu Arg Leu 115 120 125His Arg Tyr Asp Val Ser Pro Asp Thr Leu His Asn Phe Lys Asp Asn 130 135 140Thr Gly Lys Phe Val Leu Thr Gly Glu Asn Lys Asp Asn Asn Asp Glu145 150 155 160Asp Thr Asn Lys Glu Glu Lys Val Met Arg Ser Ile Leu Asn Leu Phe 165 170 175Arg Leu Ser Ser Leu Ala Phe Pro Gly Glu Ile Ile Met Glu Glu Ala 180 185 190Lys Ala Phe Ser Thr Arg Tyr Leu Lys Glu Leu Leu Glu Ile Ser Arg 195 200 205Asp Thr Phe Asn Arg Ser Phe Ile Lys Glu Val Glu Tyr Ala Leu Thr 210 215 220Tyr Glu Trp Pro Arg Thr Phe Thr Arg Trp Glu Ala Trp Asn Phe Ile225 230 235 240Glu Ile Cys Asp Leu Asp Asn Asp Arg Leu Glu Asp Lys Arg Ile Leu 245 250 255Gln Leu Ala Lys Leu Asp Phe Asn Ile Leu Gln Phe Gln Tyr Lys Leu 260 265 270Glu Met Lys Asn Leu Ser Ser Trp Trp Val Glu Ser Gly Ile Ser Asn 275 280 285Leu Val Ala Thr Arg Ala Arg His Ile Glu Tyr Leu Phe Trp Ala Val 290 295 300Ala Ser Thr Asp Glu Met Glu Phe Ser Ser Ser Arg Ile Ala Leu Ala305 310 315 320Lys Thr Thr Ala Ile Ile Thr Val Met Asp Asp Ile Phe Asp Asp Tyr 325 330 335Ala Thr Leu Glu Tyr Leu Lys Cys Ile Ser Asp Ala Ile Ser Lys Asn 340 345 350Trp Asp Val Ser Ile Ile Glu Asn Ile Pro Asn Asn Leu Lys Thr Cys 355 360 365Phe Glu Phe Ile Ser Lys Thr Val His Gln Met Ala Ile Asp Ala Thr 370 375 380Lys Tyr Gln Gly Arg Asp Met Met Pro Phe Ile Thr Lys Ala Trp Ala385 390 395 400Asp Tyr Ile Glu Ala Cys Phe Glu Glu Ala Arg Trp Lys Leu Thr Gly 405 410 415Tyr Phe Pro Thr Tyr Asp Glu Tyr Met Lys Ser Ala Glu Leu Cys Val 420 425 430Gly Phe Gly Gln Ile Phe Leu Ser Ser Gly Leu Leu Ala Ser Pro Asn 435 440 445Leu Cys Asp Asp Asp Ile Glu Lys Ile Tyr Leu Asp Lys Ser Arg Phe 450 455 460Phe Lys Leu Met Arg Val Cys Met Arg Leu Ile Asp Asp Ile Asn Asp465 470 475 480Phe Glu Asp Glu Arg Leu His Gly Lys Ile Ala Ser Ala Ile Ala Cys 485 490 495Tyr Lys Gly Asp His Pro Asn Cys Ser Glu Ser Glu Ala Ile Asn Gln 500 505 510Ile Ile Thr Leu Asn Asn Lys Leu Leu Arg Glu Leu Thr Arg Glu Phe 515 520 525Phe Lys Ser Asn Met Asn Phe Leu Glu Trp Gln Lys Ile Cys Val Asn 530 535 540Ser Thr Arg Gly Val Gln Phe Phe Tyr Ile Phe Arg Asp Gly Phe Thr545 550 555 560Tyr Ser His Lys Glu Ile Lys Gln Gln Ile Phe Lys Ile Leu Val Asp 565 570 575Pro Ile Lys Met 5804580PRTJuniperus virginiana 4Met Ser Asn Leu Lys Gly Asp His Ile Ser Ser Val Ser Ser Ile Pro1 5 10 15Ala His Ala Phe Asn Glu Trp Gly Asp Ala Phe Val Gln Ser Met Glu 20 25 30Met Pro Tyr Gly Glu Pro Glu Tyr Arg Glu Arg Ala Glu Thr Leu Val 35 40 45Lys Gln Val Lys Ile Leu Leu Lys Glu Met Gln Thr Gly Asp Gly Asp 50 55 60Leu Ile Glu Arg Leu Glu Met Val Asp Ala Leu Gln Cys Leu Gly Ile65 70 75 80Glu Arg Tyr Phe Gln Ala Glu Ile Lys Glu Ala Leu Asp Tyr Val Tyr 85 90 95Arg Ser Trp Asp Gly Thr Val Gly Ile Gly Leu Gly Cys Asn Ser Ala 100 105 110Thr Lys His Leu Asn Ala Thr Ala Leu Gly Leu Arg Val Leu Arg Leu 115 120 125His Arg Tyr Asp Val Ser Pro Asp Thr Leu His Asn Phe Lys Asp Asn 130 135 140Thr Gly Lys Phe Val Leu Thr Gly Glu Asn Lys Asp Asn Asn Asp Glu145 150 155 160Asp Thr Asn Lys Glu Glu Lys Val Met Arg Ser Ile Leu Asn Leu Phe 165 170 175Arg Leu Ser Ser Leu Ala Phe Pro Gly Glu Ile Ile Met Glu Glu Ala 180 185 190Lys Ala Phe Ser Thr Arg Tyr Leu Lys Glu Leu Leu Glu Ile Ser Arg 195 200 205Asp Thr Phe Asn Arg Ser Phe Ile Lys Glu Val Glu Tyr Ala Leu Thr 210 215 220Tyr Glu Trp Pro Arg Thr Phe Thr Arg Trp Glu Ala Arg Asn Phe Ile225 230 235 240Glu Ile Cys Asp Leu Asp Asn Asp Arg Leu Lys Asp Lys Arg Ile Leu 245 250 255Glu Leu Ala Lys Leu Asp Phe Asn Ile Leu Gln Phe Gln Tyr Gln Leu 260 265 270Glu Met Lys Asn Leu Ser Arg Trp Trp Val Glu Ser Gly Ile Ser Asn 275 280 285Leu Val Ala Thr Arg Glu Arg Ser Ile Glu Tyr Leu Phe Trp Ala Val 290 295 300Thr Ser Thr Asp Glu Leu Glu Phe Ser Ser Ser Arg Ile Ala His Ala305 310 315 320Lys Cys Thr Thr Ile Ile Thr Ile Met Asp Asp Ile Phe Asp Asp Tyr 325 330 335Ala Thr Leu Glu Gln Leu Lys Cys Ile Val Asp Ala Ile Ser Lys Asn 340 345 350Trp Asp Val Ser Ile Ile Glu Asn Ile Pro Asn Asn Leu Lys Thr Cys 355 360 365Phe Glu Phe Val Ser Lys Thr Val His Glu Leu Ala Ile Asp Ala Thr 370 375 380Glu Tyr Gln Gly Arg Asp Met Met Pro Phe Ile Thr Lys Ala Trp Thr385 390 395 400Asp Tyr Gly Glu Ala Cys Phe Glu Gln Ala Cys Trp Lys Val Lys Gly 405 410 415Tyr Phe Pro Thr Tyr Asn Glu Tyr Ile Lys Cys Ala Glu Leu Ser Val 420 425 430Ala Phe Gly Pro Ile Leu Leu His Thr Ala Leu Leu Ala Ser Pro Asp 435 440 445Leu Cys Asp Asp Asp Ile Glu Lys Ile Tyr Leu Asp Lys Ser Arg Phe 450 455 460Phe Lys Leu Met Arg Val Cys Met Arg Leu Ile Asp Asp Ile Asn Asp465 470 475 480Phe Glu Asp Glu Arg Leu His Gly Lys Ile Ala Ser Ala Ile Ala Cys 485 490 495Tyr Lys Gly Asp His Pro Asn Cys Ser Glu Ser Glu Ala Ile Asn Gln 500 505 510Ile Ile Thr Leu Asn Asn Lys Leu Leu Arg Glu Leu Thr Arg Glu Phe 515 520 525Phe Lys Ser Asn Met Asn Phe Leu Glu Trp Gln Lys Ile Cys Val Asn 530 535 540Ser Thr Arg Gly Val Gln Phe Phe Tyr Ile Phe Arg Asp Gly Phe Thr545 550 555 560Tyr Ser His Lys Glu Ile Lys Gln Gln Ile Phe Lys Ile Leu Val Asp 565 570 575Pro Ile Lys Met 58051743DNAJuniperus virginiana 5atgtcgaatt tgaaaggaga ccacatttct tctgtttctt ccattccagc ccatgctttt 60aatgagtggg gcgatgcttt tgttcaatct atggagatgc cgtacgggga acctgaatac 120cgtgaacgtg ctgaaacact tgtgaaacaa gtcaaaatct tgttaaaaga aatgcaaact 180ggagatggtg atctaatcga gcggcttgag atggttgatg ctttgcaatg ccttggcatt 240gagcgatatt ttcaggctga gattaaagaa gctcttgatt acgtttaccg ctcttgggat 300ggaactgtgg gaataggatt aggctgcaac agtgctacaa agcatttgaa tgccacagct 360ttgggactca gagtacttcg actccatcgt tatgacgtct ctccagacac gttgtacaat 420ttcaaggaca atactggcga gttcgtcctc tgtggagaaa ataaagtgag taacgatgag 480gatactaata aggaagagaa agtgatgaga agtatgctca acctgttaag actatccagt 540ttggcattcc ctggagaaat cattatggaa gaggctcaag catttagcac tagatatctt 600aaagaattat tagaaatttc tggagataca tttaacagga gttttattaa agaggtggag 660tatgctctta catatgaatg gcctcgaacc tttactagat gggaggcgtg gaatttcata 720gagatctgtg atttagataa tgacaggttg gaagacaaaa ggattttaca gcttgcaaaa 780ttggatttta atatactaca atttcaatat
aagttggaga tgaaaaatct gtcaagttgg 840tgggttgaat ctggcatctc caatctggtt gcaacaaggg cccgacatat tgaatatctt 900ttttgggcag ttgcttctac agatgagatg gagttttcta gtagtagaat agctcttgca 960aagaccaccg caattattac agtaatggat gacatttttg atgactatgc aacacttgag 1020tatctcaaat gtatttcaga tgccatttct aaaaattggg atgtttctat tatagaaaat 1080attcccaaca acttgaagac atgttttgaa tttatttcta aaacagttca tcaaatggca 1140atagatgcta ctaaatatca aggacgtgac atgatgcctt ttattacaaa agcgtgggca 1200gattatatag aagcctgctt tgaggaggca cgctggaaac tgacaggata ttttccaacc 1260tacgatgagt acatgaaatc tgctgaacta tgtgttggat ttggacagat atttttatct 1320agtgggctac tagcatctcc taatttatgt gatgatgata ttgagaagat ataccttgac 1380aaatctagat tctttaaact catgcgagtg tgtatgcggt tgattgatga tataaatgat 1440tttgaggatg agaggctcca tggaaagatt gcctcagcta ttgcttgtta caagggtgat 1500catccaaatt gttcagaaag cgaggccatc aatcaaatca tcacgctcaa taataaatta 1560ttgagagaat tgacaagaga attttttaaa tcaaatatga attttcttga atggcaaaag 1620atatgtgtca atagtaccag aggagtacaa tttttctata tatttagaga tgggtttaca 1680tattctcaca aggagatcaa gcagcagata tttaaaatcc ttgttgatcc aataaaaatg 1740tag 174361743DNAJuniperus virginiana 6atgtcgaatt tgaaaggaga ccacatttct tctgtttctt ccattccagc ccatgctttt 60aatgagtggg gcgatgcttt tgttcaatct atggagatgc cgtacgggga acctgaatac 120cgtgaacgtg ctgaaacact tgtgaaacaa gtcaaaatct tgttaaaaga aatgcaaact 180ggagatggtg atctaatcga gcggcttgag atggttgatg ctttgcaatg ccttggcatt 240gagcgatatt ttcaggctga gattaaagaa gctcttgatt acgtttaccg ctcttgggat 300ggaactgtgg gaataggatt aggctgcaac agtgctacaa agcatttgaa tgccacagct 360ttgggactca gagtacttcg actccatcgt tatgacgtct ctccagacac gttgcacaat 420ttcaaggaca atactgggaa gttcgtcctc actggagaaa ataaagacaa taacgatgaa 480gatactaata aggaagagaa agtgatgaga agtattctca acctgttcag actatccagt 540ttggcattcc ctggagaaat tattatggaa gaggctaaag catttagcac tagatatctt 600aaagaattat tagaaatttc tagagataca tttaacagga gttttattaa agaggtggag 660tatgctctta catatgaatg gcctcgaacc tttactagat gggaggcgtg gaatttcata 720gagatctgtg atttagataa tgacaggttg gaagacaaaa ggattttaca gcttgcaaaa 780ttggatttta atatactaca atttcaatat aagttggaga tgaaaaatct gtcaagttgg 840tgggttgaat ctggcatctc caatctggtt gcaacaaggg cccgacatat tgaatatctt 900ttttgggcag ttgcttctac agatgagatg gagttttcta gtagtagaat agctcttgca 960aagaccaccg caattattac agtaatggat gacatttttg atgactatgc aacacttgag 1020tatctcaaat gtatttcaga tgccatttct aaaaattggg atgtttctat tatagaaaat 1080attcccaaca acttgaagac atgttttgaa tttatttcta aaacagttca tcaaatggca 1140atagatgcta ctaaatatca aggacgtgac atgatgcctt ttattacaaa agcgtgggca 1200gattatatag aagcctgctt tgaggaggca cgctggaaac tgacaggata ttttccaacc 1260tacgatgagt acatgaaatc tgctgaacta tgtgttggat ttggacagat atttttatct 1320agtgggctac tagcatctcc taatttatgt gatgatgata ttgagaagat ataccttgac 1380aaatctagat tctttaaact catgcgagtg tgtatgcggt tgattgatga tataaatgat 1440tttgaggatg agaggctcca tggaaagatt gcctcagcta ttgcttgtta caagggtgat 1500catccaaatt gttcagaaag tgaggccatc aatcaaatcg tcatgctcaa taataaatta 1560ttgagagaat tgacaagaga atttttaaaa tcaaatatga attttcttga atgggaaaag 1620atatgtgtca atagtacaag aggggtacaa ttttgctata tatttggaga tgggtttaca 1680tattctcaca aggagatcaa gcaacagata tttaaaattc ttgtcaatcc aataaaagtg 1740tag 174371743DNAJuniperus virginiana 7atgtcgaatt tgaaaggaga ccacatttct tctgtttctt ccattccagc ccatgctttt 60aatgagtggg gcgatgcttt tgttcaatct atggagatgc cgtacgggga acctgaatac 120cgtgaacgtg ctgaaacact tgtgaaacaa gtcaaaatct tgttaaaaga aatgcaaact 180ggagatggtg atctaatcga gcggcttgag atggttgatg ctttgcaatg ccttggcatt 240gagcgatatt ttcaggctga gattaaagaa gctcttgatt acgtttaccg ctcttgggat 300ggaactgtgg gaataggatt aggctgcaac agtgctacaa agcatttgaa tgccacagct 360ttgggactca gagtacttcg actccatcgt tatgacgtct ctccagacac gttgcacaat 420ttcaaggaca atactgggaa gttcgtcctc actggagaaa ataaagacaa taacgatgaa 480gatactaata aggaagagaa agtgatgaga agtattctca acctgttcag actatccagt 540ttggcattcc ctggagaaat tattatggaa gaggctaaag catttagcac tagatatctt 600aaagaattat tagaaatttc tagagataca tttaacagga gttttattaa agaggtggag 660tatgctctta catatgaatg gcctcgaacc tttactagat gggaggcgtg gaatttcata 720gagatctgtg atttagataa tgacaggttg gaagacaaaa ggattttaca gcttgcaaaa 780ttggatttta atatactaca atttcaatat aagttggaga tgaaaaatct gtcaagttgg 840tgggttgaat ctggcatctc caatctggtt gcaacaaggg cccgacatat tgaatatctt 900ttttgggcag ttgcttctac agatgagatg gagttttcta gtagtagaat agctcttgca 960aagaccaccg caattattac agtaatggat gacatttttg atgactatgc aacacttgag 1020tatctcaaat gtatttcaga tgccatttct aaaaattggg atgtttctat tatagaaaat 1080attcccaaca acttgaagac atgttttgaa tttatttcta aaacagttca tcaaatggca 1140atagatgcta ctaaatatca aggacgtgac atgatgcctt ttattacaaa agcgtgggca 1200gattatatag aagcctgctt tgaggaggca cgctggaaac tgacaggata ttttccaacc 1260tacgatgagt acatgaaatc tgctgaacta tgtgttggat ttggacagat atttttatct 1320agtgggctac tagcatctcc taatttatgt gatgatgata ttgagaagat ataccttgac 1380aaatctagat tctttaaact catgcgagtg tgtatgcggt tgattgatga tataaatgat 1440tttgaggatg agaggctcca tggaaagatt gcctcagcta ttgcttgtta caagggtgat 1500catccaaatt gttcagaaag cgaggccatc aatcaaatca tcacgctcaa taataaatta 1560ttgagagaat tgacaagaga attttttaaa tcaaatatga attttcttga atggcaaaag 1620atatgtgtca atagtaccag aggagtacaa tttttctata tatttagaga tgggtttaca 1680tattctcaca aggagatcaa gcagcagata tttaaaatcc ttgttgatcc aataaaaatg 1740tag 174381743DNAJuniperus virginiana 8atgtcgaatt tgaaaggaga ccacatttct tctgtttctt ccattccagc ccatgctttt 60aatgagtggg gcgatgcttt tgttcaatct atggagatgc cgtacgggga acctgaatac 120cgtgaacgtg ctgaaacact tgtgaaacaa gtcaaaatct tgttaaaaga aatgcaaact 180ggagatggtg atctaatcga gcggcttgag atggttgatg ctttgcaatg ccttggcatt 240gagcgatatt ttcaggctga gattaaagaa gctcttgatt acgtttaccg ctcttgggat 300ggaactgtgg gaataggatt aggctgcaac agtgctacaa agcatttgaa tgccacagct 360ttgggactca gagtacttcg actccatcgt tatgacgtct ctccagacac gttgcacaat 420ttcaaggaca atactgggaa gttcgtcctc actggagaaa ataaagacaa taacgatgaa 480gatactaata aggaagagaa agtgatgaga agtattctca acctgttcag actatccagt 540ttggcattcc ctggagaaat tattatggaa gaggctaaag catttagcac tagatatctt 600aaagaattat tagaaatttc tagagataca tttaacagga gttttattaa agaggtggag 660tatgctctta catatgaatg gcctcgaacc tttactagat gggaggcccg gaatttcata 720gaaatctgtg atttagataa tgacaggttg aaagataaaa ggattttaga gcttgcaaaa 780ttggatttta atatactaca atttcaatat cagctggaga tgaaaaatct ctcaaggtgg 840tgggttgaat ctggcatctc caatctagtt gcaacaaggg agcgatctat tgaatatctt 900ttttgggcag ttacttctac agatgagttg gaattttcta gtagtagaat agctcatgca 960aagtgcacca caataattac aataatggat gatatttttg atgactatgc aacacttgag 1020caactcaaat gtattgtaga tgccatttca aaaaattggg atgtttctat tatagagaat 1080atacccaata acttgaagac atgctttgaa tttgtttcta aaacagttca tgaattggca 1140atagatgcta ctgaatatca aggacgtgac atgatgcctt ttattacaaa agcgtggaca 1200gattatggag aagcttgctt tgagcaggca tgctggaaag tgaaaggata ttttccaacc 1260tacaatgagt acataaagtg tgctgaatta agtgttgcat ttggaccgat attgttacat 1320actgcactac tagcatctcc cgatttatgc gatgatgata ttgagaagat ataccttgac 1380aaatctagat tctttaaact catgcgagtg tgtatgcggt tgattgatga tataaatgat 1440tttgaggatg agaggctcca tggaaagatt gcctcagcta ttgcttgtta caagggtgat 1500catccaaatt gttcagaaag cgaggccatc aatcaaatca tcacgctcaa taataaatta 1560ttgagagaat tgacaagaga attttttaaa tcaaatatga attttcttga atggcaaaag 1620atatgtgtca atagtaccag aggagtacaa tttttctata tatttagaga tgggtttaca 1680tattctcaca aggagatcaa gcagcagata tttaaaatcc ttgttgatcc aataaaaatg 1740tag 174391743DNAartificial sequencecodon optimised cDNA sequence 9atgagcaatt tgaaaggcga tcacatcagc agcgtatcta gcattccggc acatgcattc 60aatgaatggg gcgacgcctt tgttcagagc atggaaatgc cgtacggtga gccggaatat 120cgcgagcgtg cggagactct ggtcaaacaa gtgaagattc tgctgaaaga gatgcaaacc 180ggtgacggcg acttgattga acgtctggag atggtggatg cgctgcaatg cctgggtatt 240gagcgttatt tccaagcgga gattaaagag gcgctggatt acgtgtaccg tagctgggac 300ggcacggtgg gcatcggtct gggttgcaac tcggccacca agcatctgaa cgctaccgct 360ctgggcctgc gtgttctgcg cctgcatcgt tatgatgtga gccctgacac cttgtataac 420tttaaggaca ataccggcga atttgtcctg tgtggtgaga acaaagttag caatgatgaa 480gatactaaca aagaagagaa ggttatgcgc agcatgttga atttgctgcg cctgagctct 540ttggcttttc cgggtgagat catcatggaa gaagcgcagg cgtttagcac ccgttatctg 600aaagaactgc tggagatctc tggcgacacc tttaatcgta gcttcatcaa agaggtcgag 660tacgcgctga cctatgaatg gccacgtacc ttcacccgct gggaagcatg gaatttcatt 720gaaatttgtg acctggacaa cgaccgtctg gaagataagc gtatcctgca gctggcgaag 780ctggacttca acatcctgca gtttcagtac aagctggaga tgaagaatct gagcagctgg 840tgggttgaga gcggtatttc caacttggtc gcgacgcgtg cgcgccacat cgagtacttg 900ttttgggcgg tcgcgtctac ggacgagatg gagttttcca gctcccgtat cgccctggcg 960aaaaccacgg ctattatcac cgttatggat gacattttcg atgattacgc gacgctggag 1020tacctgaaat gtatttccga cgccattagc aagaattggg atgtcagcat tattgaaaac 1080atcccgaaca atctgaaaac gtgcttcgag ttcattagca aaacggtgca ccagatggcc 1140attgatgcga cgaagtatca gggccgtgac atgatgccgt ttatcactaa ggcctgggct 1200gattacattg aagcctgttt cgaagaagca cgctggaagc tgacgggtta cttcccgacc 1260tatgatgagt acatgaaaag cgcggaactg tgcgtgggtt tcggtcagat ttttctgagc 1320tcgggcctgt tggcaagccc gaatttgtgt gatgacgata ttgagaagat ttacctggat 1380aaaagccgtt tcttcaagct gatgcgcgtt tgcatgcgtc tgatcgatga catcaacgac 1440ttcgaggacg aacgtctgca cggtaagatc gcaagcgcaa tcgcatgcta taagggtgac 1500cacccgaatt gcagcgaaag cgaggcaatt aaccaaatca tcaccttgaa caataaactg 1560ctgcgcgaac tgacccgcga gtttttcaag agcaatatga actttctgga gtggcagaaa 1620atctgtgtga actccacccg tggtgtccaa ttcttctata tctttcgtga tggttttacc 1680tactctcaca aagagattaa acaacaaatc ttcaaaattc tggttgaccc gatcaagatg 1740taa 1743101743DNAartificial sequencecodon optimised cDNA sequence 10atgagcaatt tgaaaggcga tcacatcagc agcgtatcta gcattccggc acatgcattc 60aatgagtggg gtgatgcgtt cgtccaaagc atggaaatgc cgtatggtga gccggagtac 120cgtgaacgtg ctgaaacgct ggttaaacaa gtgaagattc tgctgaaaga aatgcagacc 180ggcgatggtg acctgatcga acgcctggag atggtggacg cactgcaatg tctgggtatt 240gagcgttact ttcaagccga gatcaaagaa gcgctggact acgtgtaccg cagctgggat 300ggcaccgtcg gtattggtct gggttgcaat agcgcgacca agcacctgaa tgcaacggcg 360ctgggtctgc gcgttctgcg cctgcaccgc tatgatgtta gcccggatac tctgcataac 420ttcaaggata acacgggtaa gtttgtcctg acgggcgaga acaaagacaa taacgacgaa 480gatactaaca aagaagagaa ggttatgcgt tccattctga atctgtttcg tttgagctcc 540ctggcatttc cgggcgagat cattatggaa gaggctaaag cgttctctac tcgttacctg 600aaagaactgc tggaaatcag ccgcgacacc ttcaatcgta gcttcatcaa agaggttgag 660tatgctttga cctacgagtg gcctcgcacc tttacgcgtt gggaagcgtg gaatttcatc 720gaaatttgcg acctggacaa cgaccgtctg gaagataagc gtatcttgca gctggcaaag 780ctggacttca atatcctgca atttcagtac aaactggaaa tgaagaatct gtccagctgg 840tgggtcgaga gcggtattag caacctggtg gcgacgcgtg cgcgtcatat cgaatacttg 900ttctgggcgg tcgccagcac ggacgagatg gagttcagca gctctcgtat tgccctggca 960aagaccaccg caattatcac cgtgatggat gacattttcg atgactacgc gaccctggag 1020tacctgaaat gtatttcgga tgcgatcagc aagaactggg atgtttccat tattgaaaac 1080attccgaaca acctgaaaac ctgttttgag tttatcagca aaaccgttca ccagatggcg 1140atcgatgcta cgaaatatca gggtcgtgac atgatgccat tcattacgaa ggcgtgggcc 1200gactatattg aggcatgttt cgaagaagcg cgttggaagc tgacgggcta ctttccgacc 1260tacgacgagt atatgaagag cgcggaattg tgcgttggtt ttggtcagat ctttctgagc 1320tctggcctgt tggcttcccc gaatctgtgc gacgacgaca ttgagaaaat ctatttggac 1380aagtcccgct tcttcaagct gatgcgtgtt tgtatgcgct tgatcgatga cattaacgat 1440ttcgaggatg agcgtctgca cggcaaaatc gccagcgcca tcgcctgcta taaaggcgac 1500catccgaatt gtagcgagtc tgaggcgatc aaccagatcg tgatgctgaa taacaaattg 1560ctgcgcgaac tgacccgcga gttcctgaag agcaatatga actttctgga gtgggagaag 1620atttgcgtga acagcacccg tggtgtgcaa ttctgctaca tttttggcga tggttttacc 1680tatagccaca aagaaatcaa acaacagatc tttaagattc tggtcaatcc gatcaaggtc 1740taa 1743111743DNAartificial sequencecodon optimised cDNA sequence 11atgagcaatt tgaaaggcga tcacatcagc agcgtatcta gcattccggc acatgcattc 60aatgagtggg gtgacgcgtt tgtgcagagc atggaaatgc cgtatggtga accggaatat 120cgtgagcgtg ctgaaaccct ggtgaagcaa gtcaagattc tgttgaaaga aatgcaaacc 180ggcgacggtg atctgatcga gcgcctggag atggttgatg cgctgcagtg tctgggtatt 240gagcgctatt ttcaagccga gatcaaagaa gcgctggatt acgtttatcg tagctgggat 300ggcacggttg gtattggcct gggctgcaat agcgcgacca agcacctgaa cgctaccgcg 360ctgggtctgc gcgtgttgcg tttgcaccgc tacgacgttt cgccggatac tctgcataac 420tttaaagata atacgggcaa attcgtcctg acgggtgaga acaaagataa caacgatgag 480gacacgaaca aagaagaaaa agtcatgcgc tccatcctga atctgtttcg tctgagcagc 540ctggcttttc ctggcgagat cattatggaa gaagcgaagg cgtttagcac ccgttacctg 600aaagaactgt tggagatcag ccgtgatacc ttcaaccgta gctttatcaa agaggtggag 660tacgcgctga cctacgagtg gccgcgtacc tttacccgtt gggaagcctg gaatttcatt 720gagatctgcg acctggataa cgaccgtctg gaagataagc gtattctgca attggcgaaa 780ctggacttca atattctgca gttccagtac aagctggaga tgaagaatct gtccagctgg 840tgggttgaga gcggtatcag caacctggtc gcgacgcgtg cacgtcatat cgagtacctg 900ttttgggcgg tcgctagcac ggacgaaatg gagtttagct ccagccgcat tgcactggcc 960aagaccactg caatcattac cgtgatggat gatatctttg acgattacgc gaccttggag 1020tatctgaaat gcatctctga cgcgatcagc aagaactggg acgttagcat tattgaaaac 1080attccgaata acttgaaaac gtgttttgag ttcattagca aaactgttca ccaaatggca 1140atcgacgcca ccaaatatca gggccgtgac atgatgccgt ttatcaccaa ggcctgggca 1200gactacatcg aggcatgctt tgaagaagct cgctggaaac tgacgggtta tttcccgacc 1260tacgatgagt acatgaagtc cgccgagctg tgcgtcggct tcggtcagat tttcctgtcg 1320agcggtctgc tggcaagccc aaatctgtgt gacgacgaca ttgaaaagat ttacttggac 1380aagagccgct ttttcaagct gatgcgtgtg tgtatgcgtc tgattgatga cattaacgat 1440ttcgaggacg aacgcctgca cggtaagatc gcgtccgcca ttgcgtgcta caagggcgac 1500catccgaatt gctctgaatc tgaagcgatt aaccaaatca tcaccctgaa caataaactg 1560ctgcgtgagt tgacccgtga gttcttcaag tctaacatga attttctgga gtggcagaag 1620atttgtgtta atagcacgcg cggtgtgcaa ttcttctata tcttccgcga tggtttcacg 1680tatagccaca aagagatcaa gcagcagatt ttcaaaatcc tggtggaccc gatcaaaatg 1740taa 1743121743DNAartificial sequencecodon optimised cDNA sequence 12atgagcaatt tgaaaggcga tcacatcagc agcgtatcta gcattccggc acatgcattc 60aacgagtggg gcgacgcttt cgtgcaatct atggagatgc cgtatggtga gccggagtac 120cgtgagcgtg cggaaacgct ggtgaaacaa gttaagatcc tgctgaaaga gatgcagacc 180ggtgatggcg atctgattga acgtctggag atggtcgatg cgctgcaatg cctgggtatc 240gaacgttact tccaggcgga gatcaaagag gccctggact atgtttaccg tagctgggat 300ggcacggtcg gtattggtct gggttgcaac agcgcgacga aacacctgaa cgcgacggct 360ctgggtctgc gcgttctgcg cctgcaccgt tacgatgtca gcccggacac gctgcataac 420tttaaggaca atacgggcaa atttgtgctg actggtgaaa acaaagataa caacgacgag 480gataccaata aagaagaaaa ggtcatgcgt tccatcctga atttgttccg cctgagcagc 540ttggcctttc cgggcgagat cattatggaa gaagcgaagg cgtttagcac ccgttatctg 600aaagaactgc tggaaattag ccgcgacacc tttaaccgca gctttatcaa agaagtcgaa 660tacgccctga cctacgagtg gccgcgtacc tttacccgtt gggaagcgcg taatttcatt 720gaaatctgtg atttggataa tgaccgtctg aaggataagc gtatcctgga gctggcgaag 780ctggacttta acattttgca gttccaatat cagttggaga tgaaaaatct gagccgctgg 840tgggtggaga gcggtattag caacttggtt gccactcgtg agcgttccat tgaatacctg 900ttctgggcgg tcacgtctac cgacgaactg gagtttagct ctagccgcat cgcgcacgcg 960aaatgcacca cgatcatcac catcatggat gatatctttg acgattatgc aaccctggag 1020caactgaagt gtattgtgga cgctatttcg aagaactggg acgtttccat cattgagaac 1080attccgaata atctgaaaac ctgtttcgag ttcgtgagca aaaccgttca cgagctggca 1140attgatgcca ccgagtatca aggtcgtgac atgatgccgt tcatcaccaa ggcctggacc 1200gattatggtg aagcatgttt cgagcaggct tgctggaagg tgaagggtta ctttcctacc 1260tacaacgagt atatcaagtg cgcagaactg agcgtcgcct ttggcccgat tctgctgcat 1320acggcgctgt tggcgagccc agacctgtgc gacgatgaca ttgagaaaat ctatttggac 1380aagtcgcgct tctttaaact gatgcgcgtt tgtatgcgcc tgattgacga cattaatgac 1440ttcgaggatg agcgcttgca cggcaagatt gcaagcgcga ttgcatgcta caagggtgat 1500catccgaatt gcagcgaatc cgaggcaatc aaccagatca ttactctgaa caataaactg 1560ctgcgtgaac tgacgcgtga gttctttaag agcaatatga attttctgga atggcagaag 1620atttgtgtta actccacccg tggcgttcag ttcttctaca tcttccgtga cggtttcacc 1680tacagccaca aagaaatcaa acagcaaatc ttcaaaatcc tggtggaccc gatcaagatg 1740taa 174313582PRTPlatycladus orientalis "Beverleyensis" 13Met Ser Asn Leu Met Gly Asp His Ile Ser Ser Leu Ser Ser Ile Pro1 5 10 15Ser Asn Ala Phe Asn Gln Trp Asp Asp Ala Phe Ile Gln Ser Met Glu 20 25 30Thr Pro Tyr Gly Glu Pro Glu Tyr Arg Glu Arg Ala Glu Thr Leu Ala 35 40 45Lys Glu Ile Lys Ile Phe Leu Lys Asp Met Gln Ser Gly Gly Gly Asp 50 55 60Gly Asp Leu Ile Glu Arg Leu Glu Ile Val Asp Ala Leu Gln Cys Leu65 70 75 80Gly Ile Asp Arg Tyr Phe Gln Ala Glu Ile Lys Ala Ala Leu Asp Tyr 85 90 95Val Tyr Asn Cys Trp Asp Glu Ser Val Gly Ile Gly Leu Gly Ser Gln 100 105 110Ser Ala Thr Lys Asp Leu Asn Ala Thr Ala Leu Ala Leu Arg Val Phe 115 120 125Arg Leu Asn Arg Tyr Asp Val Ser Ala Asp Thr Leu Lys Tyr Phe Lys 130 135 140Asp Asn Asn Gly Arg Phe Val Leu Cys Gly Asp Asn Lys Asp Asn Asn145 150 155 160Asp Glu Asp Asn Ser Lys Glu Glu Lys Val Met Arg Ser Met Leu Asn 165 170 175Leu Leu Arg Leu Ser Ser Leu
Ala Phe Pro Ala Glu Ile Val Met Glu 180 185 190Glu Ala Lys Ala Phe Ser Ser Arg Tyr Leu Lys Glu Leu Leu Gly Lys 195 200 205Ser Gly Asp Thr Ser Lys Lys Ser Phe Leu Lys Glu Val Glu Tyr Ala 210 215 220Leu Ile Tyr Glu Trp Pro Arg Thr Phe Ile Arg Trp Glu Ala Arg Asn225 230 235 240Phe Ile Glu Ile Tyr Glu Leu Asp Asn Glu Arg Leu Lys Glu Lys Arg 245 250 255Ile Leu Glu Leu Ala Lys Leu Asp Phe Asn Ile Leu Gln Phe His Tyr 260 265 270Lys Leu Glu Met Lys Asn Leu Ser Ser Trp Trp Val Glu Ser Glu Ile 275 280 285Ser Lys Leu Ile Ala Thr Arg Glu Arg Ser Ile Glu Tyr Leu Leu Trp 290 295 300Ala Ile Ser Ser Met Asp Glu Leu Glu His Ser Ser Ser Arg Ile Ala305 310 315 320Leu Ala Lys Ile Thr Ser Leu Ile Thr Ile Leu Asp Asp Ile Phe Asp 325 330 335Asp Tyr Ala Thr Phe Glu Gln Leu Lys Cys Ile Arg Asp Ala Ile Phe 340 345 350Lys Gly Trp Asp Val Ser Ile Ile Glu Asn Ile Pro Asn Asn Trp Lys 355 360 365Arg Cys Val Glu Phe Val Phe Lys Thr Ile His Gln Leu Thr Ile Asp 370 375 380Ala Thr Asp Tyr Gln Gly Arg Asp Met Met Pro Phe Val Ser Lys Ala385 390 395 400Trp Glu Asp Tyr Val Glu Ala Cys Phe Glu Gln Ala Arg Trp Lys Leu 405 410 415Lys Gly Tyr Phe Pro Thr Tyr Asn Glu Tyr Ile Lys Ile Ala Gly Lys 420 425 430Cys Val Gly Phe Gly Pro Phe Ser Leu His Ser Ala Ile Leu Ala Ser 435 440 445Pro Asn Leu Cys Asp Asp Asp Ile Gln Lys Ile Tyr Leu Asp Lys Ser 450 455 460Arg Phe Tyr Gln Leu Met Arg Val Ala Met Arg Leu Ile Asp Asp Ile465 470 475 480His Asp Phe Glu Glu Glu Arg Leu His Gly Lys Met Ala Ser Ala Ile 485 490 495Ser Cys Tyr Met Ala Asp His Pro Asn Cys Ser Glu Lys Glu Ala Met 500 505 510Asn His Ile Ile Glu Leu Asn Asn Glu Val Leu Lys Glu Leu Thr Arg 515 520 525Glu Phe Leu Lys Pro Ser Met Ile Phe His Glu Trp Glu Lys Ile Phe 530 535 540Val Asn Ser Thr Arg Gly Val Gln Phe Phe Tyr Val His Gly Asp Gly545 550 555 560Phe Thr Tyr Thr His Lys Glu Ile Lys His Gln Ile Leu Lys Ile Ile 565 570 575Val Asp Pro Ile Lys Ile 58014576PRTPlatycladus orientalis 14Met Ser Thr Leu Glu Gly Asp Asn Ile Tyr Ser Val Ser Ser Leu Pro1 5 10 15Ala His Ala Phe Asn Glu Trp Glu Asp Ala Ser Val Gln Ser Met Glu 20 25 30Met Ser Tyr Gly Glu Pro Glu Tyr Arg Glu Arg Ala Glu Thr Leu Val 35 40 45Lys Glu Val Lys Ile Leu Leu Lys Glu Met His Thr Gly Asp Gly Asp 50 55 60Leu Ile Glu Arg Leu Glu Met Val Asp Ala Leu Gln Cys Leu Gly Ile65 70 75 80Tyr Arg Tyr Phe Gln Ala Glu Ile Lys Gln Ala Leu Asp Tyr Val Tyr 85 90 95Ser Cys Trp Asp Gly Asn Val Gly Ile Gly Leu Gly Ser Glu Ser Pro 100 105 110Thr Gln His Leu Asn Ala Thr Ala Leu Gly Ile Arg Val Leu Arg Leu 115 120 125His Arg Tyr Asp Val Ser Ala Asp Thr Leu Lys Asn Phe Lys Asp Lys 130 135 140Asn Gly Gln Phe Val Leu Cys Gly Gly Asn Asn Asp Asn Asn Asp Glu145 150 155 160Glu Glu Lys Val Met Arg Ser Met Leu Asn Leu Phe Arg Leu Ser Ser 165 170 175Val Ala Ile Pro Gly Glu Met Val Leu Glu Glu Ala Lys Ala Phe Ser 180 185 190Ser Arg Tyr Leu Lys Glu Leu Leu Glu Asn Ser Gly Asp Thr Val Lys 195 200 205Arg Ser Phe Ile Lys Glu Val Glu Tyr Ala Leu Thr Tyr Glu Trp Pro 210 215 220Ile Thr Phe Asp Arg Trp Glu Ala Leu Asn Phe Ile Glu Ile Tyr Asp225 230 235 240Leu Asn Asn Glu Arg Leu Met Asp Lys Arg Ile Leu Glu Leu Ala Lys 245 250 255Leu Asn Phe Asn Ile Leu Gln Phe Gln Tyr Lys Leu Glu Met Lys Asn 260 265 270Leu Ser Ser Trp Trp Ala Lys Ser Gly Ile Ser Lys Leu Leu Ala Val 275 280 285Arg Glu Arg Ser Ile Glu Tyr Leu Phe Trp Ala Ile Thr Ser Val Glu 290 295 300Glu Leu Glu Leu Ser Ser Ser Arg Ile Ala Leu Val Lys Cys Thr Thr305 310 315 320Val Ile Thr Ile Val Asp Asp Ile Phe Asp Asp Tyr Ala Thr Phe Glu 325 330 335Gln Leu Gln Cys Ile Thr Asp Ala Ile Ser Lys Asp Trp Asp Val Ser 340 345 350Leu Leu Glu Asn Ile Pro Ser Asn Leu Lys Thr Ser Leu Glu Phe Val 355 360 365Ser Lys Thr Ile His Glu Leu Ala Met Asp Ala Thr Lys Tyr Gln Gly 370 375 380Arg Asp Met Met Pro Phe Val Thr Lys Ala Trp Leu Asp Tyr Thr Asn385 390 395 400Ala Cys Phe Glu Gln Ala Arg Trp Lys Val Thr Gly Tyr Phe Pro Ser 405 410 415Tyr Asn Glu Tyr Ile Lys Ala Ala Glu Leu Ser Val Ala Phe Gly Pro 420 425 430Ile Leu Leu His Thr Ala Leu Ala Ala Ser Pro Ile Leu Cys Asp Glu 435 440 445Asp Ile Glu Lys Ile Tyr Leu Asp Lys Ser Arg Phe Tyr His Ile Met 450 455 460Arg Val Ser Met Arg Leu Thr Asp Asp Ile His Asp Phe Glu Asp Glu465 470 475 480Arg Leu His Gly Lys Met Ala Ser Ala Ile Ser Cys Tyr Lys Gly Asp 485 490 495His Pro Asn Cys Ser Glu Glu Glu Ala Ile Asn Asn Ile Val Thr Leu 500 505 510Asn Asn Glu Leu Leu Lys Glu Met Ile Arg Glu Phe Phe Lys Pro Asn 515 520 525Ser His Tyr Leu Glu Trp Glu Lys Ile Cys Val Asn Ser Thr Arg Gly 530 535 540Ile Gly Phe Phe Tyr Ile Phe Gly Asp Gly Phe Thr Tyr Ser His Lys545 550 555 560Glu Ile Lys Glu Gln Ile Phe Lys Ile Ile Val Asn Pro Ile Lys Val 565 570 575151749DNAPlatycladus orientalis "Beverleyensis" 15atgtctaatt tgatgggaga tcacatttct tctctttctt ccattccatc caatgctttc 60aatcagtggg acgatgcgtt tattcaatct atggagacgc catacgggga acctgaatac 120cgtgaacgtg ctgaaacact tgctaaggaa ataaaaatct ttttaaaaga catgcaatct 180ggaggtggag atggcgatct aatcgagcgg cttgagattg ttgacgcctt gcaatgcctc 240ggaatagatc gttattttca ggctgaaata aaagcggctc ttgattacgt ttataactgt 300tgggatgaaa gtgtggggat aggattaggg agccaaagtg ctacaaagga tttgaatgct 360acagctttag cacttcgagt gtttcgactt aatcgttatg atgtgtctgc agacacgttg 420aagtatttca aggataataa tgggcggttc gtactctgtg gagacaataa agacaacaac 480gacgaggata atagcaaaga agaaaaagtg atgagaagta tgctcaacct gttaagactt 540tccagtttgg catttcctgc agaaatcgtt atggaagagg ctaaagcatt cagttctaga 600tatcttaaag aactattagg aaaatctgga gatacatcta agaaaagttt tcttaaagag 660gtggagtatg cccttatata tgaatggcct cgaacattta ttagatggga ggcacgaaat 720ttcatagaaa tctatgaact agataatgag aggttaaaag agaaaaggat tttagaactt 780gcgaaattgg attttaacat actacaattt cactacaagc tagagatgaa aaatctctca 840agttggtggg ttgaatctga aatctccaag ctaattgcaa caagagaacg atccattgaa 900tatcttttgt gggcaattag ttctatggat gaattggagc attctagtag tagaatagct 960cttgcaaaaa tcacatcact tatcacaata ttggatgata tttttgatga ctatgcaaca 1020tttgagcaac tcaaatgcat tagggatgcc atttttaaag gttgggatgt ttctatcata 1080gaaaacattc ccaacaactg gaaaagatgc gtggaatttg tttttaaaac aattcatcaa 1140ttgacaatag atgctactga ttatcaaggg cgtgacatga tgccttttgt ttcaaaagcg 1200tgggaagatt atgtggaagc ctgctttgag caggcacgat ggaaattgaa aggatatttt 1260ccaacctaca atgagtacat aaagatagct ggaaaatgtg tagggtttgg acccttttct 1320ttacattctg ccatactagc atctccaaat ttatgtgatg atgatattca gaagatatac 1380cttgataaat ctagatttta tcaactcatg cgagtggcta tgaggttaat tgatgatata 1440cacgactttg aggaagagag actccatgga aagatggcct cagctatttc ttgttatatg 1500gctgatcatc caaattgttc agagaaagag gcaatgaatc atatcatcga actaaataat 1560gaagtattga aggaattgac aagagaattt ttaaaaccaa gtatgatatt tcatgagtgg 1620gagaagatat ttgtcaattc tactcgagga gtacaatttt tctatgtaca tggtgatgga 1680tttacatata cgcataagga gatcaagcat cagatactaa aaattattgt cgatccaata 1740aaaatctag 1749161731DNAPlatycladus orientalis 16atgtcgactt tggaaggaga caacatttat tctgtttctt ccttaccagc ccatgctttt 60aatgagtggg aagatgcttc tgttcaatct atggagatgt catacgggga acctgaatac 120cgtgaacgtg ctgaaacact tgtgaaagaa gtaaaaatct tgttgaaaga aatgcacact 180ggagatggcg atctaatcga gcggcttgag atggttgatg cattgcaatg ccttggaatt 240tatcgatact ttcaggctga gattaaacaa gctcttgatt acgtttacag ctgctgggat 300ggaaatgtgg ggataggatt aggctccgag agtcctacac agcatttgaa tgccacagct 360ttgggaatca gagtactgcg actccatcgt tatgatgtgt ctgcagacac gttgaagaat 420ttcaaggaca aaaatgggca gttcgtactc tgtggaggaa ataatgacaa taacgatgag 480gaagagaaag tgatgagaag tatgctcaac ctgttcagac tttccagtgt ggcaattcct 540ggagaaatgg ttctggaaga ggctaaagca tttagcagta gatatcttaa agaattatta 600gaaaattctg gagatacagt taagagaagt tttattaaag aggtggagta tgctcttacc 660tatgaatggc ctataacttt tgatagatgg gaggcactga atttcataga aatctatgat 720ttaaataatg agaggttgat ggacaaaagg atattagagc ttgcaaaatt gaattttaat 780atactacaat ttcaatacaa gttggagatg aaaaatctct caagttggtg ggctaaatct 840ggcatctcga aactacttgc agtaagggag cgatccattg aatatctttt ttgggcaatt 900acttctgtag aagaattgga gctttctagt agtagaatag ctcttgtaaa gtgcacaaca 960gttattacaa tagtggatga tatttttgat gactatgcaa catttgagca actccaatgt 1020attacagatg ctatctctaa agattgggat gtttctcttt tagaaaacat tcccagcaac 1080ttgaagacaa gcttggaatt tgtttcaaaa acaattcatg agttggcaat ggatgctact 1140aaatatcaag ggcgtgacat gatgcctttt gttacaaaag cgtggttaga ttacacgaac 1200gcctgctttg agcaagcacg atggaaagtg actggttatt ttccaagcta caatgagtac 1260ataaaggctg ctgaattaag tgtagcattt ggaccgatat tgttacatac tgccctagca 1320gcatctccta ttttatgcga tgaagatatt gagaagatat accttgataa atctagattc 1380tatcatatca tgcgagtgtc tatgcggttg actgatgata tacatgattt tgaggatgag 1440aggctgcatg gaaagatggc ttcagctatt tcttgttata agggtgatca tccaaattgt 1500tcagaagaag aggcaataaa taatattgtc accctcaata atgaattatt gaaggaaatg 1560ataagggaat tttttaaacc aaatagtcat tatcttgaat gggaaaagat atgtgtcaat 1620agtactagag gaataggatt tttctatata tttggagatg ggtttacata ttctcacaag 1680gaaatcaagg agcagatatt taaaattatt gttaatccaa taaaagtgta g 1731171749DNAartificial sequencecodon optimised cDNA sequence 17atgtccaacc tgatgggcga tcatattagc tctctgagtt ccatcccgtc caacgctttt 60aatcagtggg atgacgcgtt cattcaatca atggaaaccc cgtatggtga accggaatac 120cgtgaacgcg ctgaaacgct ggcgaaagaa atcaaaatct tcctgaaaga tatgcagtct 180ggcggtggcg acggcgatct gattgaacgt ctggaaatcg tggacgccct gcagtgcctg 240ggtattgatc gctattttca agcagaaatc aaagcggccc tggactatgt ttacaactgt 300tgggatgaat cggtcggtat tggcctgggt tcccaatcag ccaccaaaga tctgaacgca 360acggctctgg cgctgcgtgt gtttcgcctg aatcgttatg acgtttctgc ggataccctg 420aaatacttca aagataacaa cggccgtttc gttctgtgcg gtgacaacaa agataacaac 480gacgaagata actctaaaga agaaaaagtc atgcgtagta tgctgaatct gctgcgcctg 540tcatcgctgg ctttcccggc ggaaattgtc atggaagaag ccaaagcatt tagctctcgc 600tatctgaaag aactgctggg caaaagcggt gataccagca aaaaatcttt tctgaaagaa 660gtggaatacg ccctgattta cgaatggccg cgcacgttca tccgttggga agcacgcaac 720ttcatcgaaa tctacgaact ggacaacgaa cgtctgaaag aaaaacgcat tctggaactg 780gcgaaactgg attttaacat cctgcagttc cattacaaac tggaaatgaa aaacctgagt 840tcctggtggg tggaatctga aattagtaaa ctgatcgcta cccgtgaacg ctccattgaa 900tatctgctgt gggcgatctc atcgatggat gaactggaac acagctctag tcgtattgct 960ctggcgaaaa tcacctcact gattacgatc ctggatgaca tttttgatga ctacgctacc 1020ttcgaacagc tgaaatgcat tcgtgacgcg atcttcaaag gctgggatgt tagtattatc 1080gaaaacatcc cgaacaattg gaaacgctgt gtggaatttg ttttcaaaac gattcatcag 1140ctgaccatcg acgctacgga ttatcaaggt cgtgacatga tgccgtttgt cagcaaagca 1200tgggaagatt atgtggaagc ctgtttcgaa caggcacgct ggaaactgaa aggctacttt 1260ccgacctata acgaatacat taaaatcgcc ggtaaatgcg ttggctttgg tccgttctcc 1320ctgcactcag ccattctggc atctccgaat ctgtgtgatg acgatatcca gaaaatctac 1380ctggataaaa gtcgtttcta ccaactgatg cgtgtcgcga tgcgcctgat tgacgatatc 1440catgattttg aagaagaacg cctgcacggc aaaatggcct cggcaattag ctgctatatg 1500gccgatcatc cgaactgtag cgaaaaagaa gcaatgaatc acattatcga actgaacaat 1560gaagtgctga aagaactgac ccgtgaattt ctgaaaccgt cgatgatctt ccatgaatgg 1620gaaaaaatct tcgttaacag cacgcgcggt gtccagtttt tctatgtgca cggcgacggt 1680ttcacctaca cgcataaaga aatcaaacac caaatcctga aaattatcgt tgatccgatt 1740aaaatctaa 1749181749DNAartificial sequencecodon optimised cDNA sequence 18atgtctaatt tgatgggtga tcacatttcg agcctgagca gcattccgag caacgcattc 60aatcagtggg atgacgcatt catccagtcg atggaaaccc cgtatggtga gccggagtac 120cgtgagcgtg cggaaaccct ggcaaaagaa atcaagattt ttctgaaaga catgcagagc 180ggcggcggcg atggcgatct gatcgagcgt ttggaaatcg tggatgcgct gcaatgcctg 240ggtatcgacc gttacttcca agccgagatc aaagctgccc tggactacgt ttataattgt 300tgggacgagt ctgttggcat tggtctgggt agccagagcg ccactaaaga tctgaacgca 360acggcgctgg cgctccgtgt tttccgcttg aaccgttacg acgtcagcgc ggacacctta 420aagtatttca aagataacaa cggtcgtttt gtgctgtgtg gcgataataa agacaacaat 480gacgaagata acagcaaaga agaaaaagtc atgcgcagca tgctgaattt gctgcgtctg 540agcagcctgg cgtttcctgc tgagattgtc atggaagaag caaaggcctt tagctctcgt 600tatctgaaag aactgctggg taagagcggc gataccagca aaaagtcgtt tttgaaagaa 660gtggagtacg cactgattta tgagtggccg cgtaccttca tccgctggga ggcacgcaac 720tttatcgaga tctacgaact ggacaacgaa cgcctgaaag aaaagcgtat cttggaactg 780gcgaaactgg acttcaacat tctgcagttc cactataaac tggagatgaa gaatttgtcc 840tcctggtggg tggagtccga gatcagcaag ctgattgcga cgcgtgagcg tagcattgag 900tatctgctgt gggctattag cagcatggac gaactggagc actccagcag ccgtatcgcc 960ctggcgaaga ttacctctct gattaccatt ctggatgata tttttgacga ctacgcgacc 1020tttgagcaac tgaagtgcat ccgcgacgcc atcttcaagg gctgggatgt tagcatcatt 1080gagaacatcc cgaacaattg gaaacgttgt gttgaatttg tctttaagac gattcatcaa 1140ctgaccatcg acgctacgga ctaccagggt cgcgacatga tgccgttcgt gagcaaagcg 1200tgggaagatt atgttgaggc gtgcttcgag caagcgcgtt ggaagctgaa gggttacttt 1260ccgacgtaca acgaatacat caagatcgcg ggtaaatgcg tcggtttcgg tccattctcc 1320cttcatagcg cgattttggc gagcccgaac ctgtgcgatg acgacatcca aaagatctat 1380ctggataaga gccgttttta tcaattgatg cgcgtcgcga tgcgtctgat tgacgacatt 1440cacgactttg aagaggaacg cctgcacggt aaaatggcct ccgcgatcag ctgctacatg 1500gcagatcacc cgaactgttc agagaaagag gcaatgaacc acattattga gttgaataat 1560gaagtcctga aagaactgac ccgtgagttc ctgaaaccga gcatgatctt ccatgagtgg 1620gaaaagatct ttgtgaatag cacgcgcggt gtgcaattct tttacgttca cggcgatggc 1680ttcacctaca cgcataaaga aatcaagcat cagattctga agattatcgt ggacccgatt 1740aagatttaa 1749191731DNAartificial sequencecodon optimised cDNA sequence 19atgagcaccc tggaaggcga caacatctac agcgtgagca gcctgccggc gcacgcgttc 60aacgagtggg aagatgcgag cgttcagagc atggagatga gctacggtga accggaatat 120cgtgagcgtg cggaaaccct ggtgaaggaa gttaaaatcc tgctgaagga gatgcacacc 180ggtgacggcg atctgattga gcgtctggaa atggtggacg cgctgcaatg cctgggcatc 240taccgttatt ttcaggcgga aattaaacaa gcgctggact acgtgtatag ctgctgggat 300ggcaacgttg gtatcggtct gggtagcgag agcccgaccc agcacctgaa cgcgaccgcg 360ctgggtattc gtgtgctgcg tctgcaccgt tacgacgtta gcgcggatac cctgaagaac 420ttcaaggata aaaacggtca atttgtgctg tgcggtggca acaacgacaa caacgatgag 480gaagagaaag ttatgcgtag catgctgaac ctgttccgtc tgagcagcgt ggcgatcccg 540ggtgaaatgg ttctggaaga ggcgaaggcg tttagcagcc gttatctgaa agagctgctg 600gaaaacagcg gtgacaccgt gaagcgtagc ttcatcaaag aggttgaata cgcgctgacc 660tatgagtggc cgattacctt cgatcgttgg gaagcgctga actttatcga gatttacgac 720ctgaacaacg aacgtctgat ggataagcgt atcctggagc tggcgaaact gaacttcaac 780attctgcagt ttcaatataa gctggaaatg aaaaacctga gctcctggtg ggcgaagagc 840ggcatcagca aactgctggc ggttcgtgag cgtagcatcg aatacctgtt ttgggcgatt 900accagcgtgg aagagctgga gctgagcagc agccgtatcg cgctggttaa gtgcaccacc 960gtgatcacca ttgttgacga tattttcgac gattatgcga cctttgaaca gctgcaatgc 1020atcaccgacg cgattagcaa agactgggat gtgagcctgc tggagaacat cccgagcaac 1080ctgaagacca gcctggaatt cgttagcaaa accattcacg agctggcgat ggacgcgacc 1140aagtaccagg gtcgtgatat gatgccgttt gtgaccaaag cgtggctgga ttacaccaac 1200gcgtgcttcg agcaagcgcg ttggaaggtg accggctatt ttccgagcta caacgaatat 1260atcaaagcgg cggagctgag cgttgcgttc ggtccgatcc tgctgcacac cgcgctggcg 1320gcgagcccga ttctgtgcga cgaggatatc gaaaagattt acctggacaa aagccgtttc 1380tatcacatca tgcgtgttag catgcgtctg accgacgata ttcacgactt tgaggatgaa 1440cgtctgcacg gcaagatggc gagcgcgatt agctgctaca aaggtgatca cccgaactgc 1500agcgaagagg aagcgatcaa caacattgtg accctgaaca acgagctgct gaaggaaatg 1560atccgtgagt tctttaaacc gaacagccac tatctggagt gggaaaagat ttgcgttaac 1620agcacccgtg gcatcggttt cttttacatt ttcggcgacg gttttaccta tagccacaag
1680gagatcaaag aacagatttt caagatcatt gtgaacccga tcaaagttta a 17312019DNAartificial sequenceprimer sequence 20tttaagtgct tctgcgatg 192119DNAartificial sequenceprimer sequence 21acatctaggt ttgtgcctt 192218DNAartificial sequenceprimer sequence 22atcgccatct ccagtgtg 182319DNAartificial sequenceprimer sequence 23ctttagtgct tctgtgatg 192419DNAartificial sequenceprimer sequence 24catacaagtt tgtgcctca 19